Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g5896.t1
Gene name
Locationscaffold_042:79215..81682
Strand-
Gene length (bp)2467
Transcript length (bp)1980
Coding sequence length (bp)1980
Protein length (aa) 660

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01212 Beta_elim_lyase Beta-eliminating lyase 1.9E-68 312 605
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 2.3E-25 98 224
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 1.8E-06 131 259

GO

GO Term Description Terminal node
GO:0006520 cellular amino acid metabolic process Yes
GO:0016829 lyase activity Yes
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0044281 small molecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g5896.t1
MTRRTRRSWIGCCSRLAGERPSHWRHRRNTELAACASFALLGDNRSVLSFSCRVRIPSGISLEAAAPVLCAGITV
YKALKESEVQPGQIIAIVGAGGGLGSLACQYAKACGHKVLALSSGAAKRQMCLYDLGADYFVDYKSPDVAEEVKR
VTGGGPHAAMIVSSVEEPFHQATQYIRPGGTIVAVGLPPGKICTDLFHMITQRINIKGSYVGNRDETEEALAIII
KAGIRVQYEVVDFSELPNIYDQMEKGTMKGRAVLKIGKTLSRGPERQSSLCRDLHFSPKQTNGITGLTAKGAVSG
ALERAIERAGRDFRSDTVTVPTEAVMEAIVNASTFGDDIYDEEGDATVNEFQEKIKALTGKEAALFVVSGTQGNQ
ICLRTHLHQPPHTILLDYRAHVQTWETGAIPVLSQATVTSVEPKNGVHLTLEDVKDRIIEEGNFHFPPTRVVSLE
NTLSGSILPLKDAREISNYVRRVRVPPGRAPIAMHLDGARLLEGITAEGVTAREYLDCFDSASICISKGCGAPMG
SVIVGTREFIDRAKWFRKMFGGATRQTGMMAAAAIAAMEHTLPLLPKVHALTRRVADYLHRIGYEFLMPVDTNMI
VLDLKKTGITGDDIVFYCKQQGLLVFPNGRLAFHHQISDDGVARLQRALLELITDKKRY*
Coding >Ani_SJS72_1|g5896.t1
ATGACTAGGCGGACACGAAGGAGTTGGATTGGTTGCTGCAGTCGGCTCGCAGGTGAACGGCCTTCGCATTGGAGA
CACCGTCGGAATACAGAACTTGCGGCGTGTGCGAGTTTTGCTCTACTGGGAGACAACCGCTCTGTCCTAAGCTTC
AGCTGTCGGGTGCGCATTCCGTCCGGAATTTCTCTAGAGGCCGCTGCCCCGGTTCTCTGTGCCGGAATTACCGTA
TACAAGGCCCTCAAAGAAAGTGAAGTCCAGCCAGGACAGATCATCGCCATTGTCGGCGCAGGCGGAGGACTGGGC
TCTCTGGCCTGCCAATATGCCAAGGCATGCGGACATAAGGTCCTTGCCTTATCGTCCGGGGCCGCCAAGAGGCAA
ATGTGTCTATACGATCTTGGAGCGGATTACTTTGTCGATTACAAGTCTCCGGACGTTGCGGAGGAGGTGAAGCGC
GTCACCGGCGGCGGACCGCATGCTGCGATGATAGTGTCATCCGTGGAGGAGCCTTTCCACCAGGCTACACAGTAC
ATTCGCCCGGGCGGAACAATCGTCGCTGTCGGTCTCCCACCTGGGAAAATCTGCACTGACCTCTTCCATATGATA
ACCCAGCGGATTAACATTAAGGGGTCCTACGTGGGGAATAGAGATGAAACCGAGGAAGCGCTTGCCATCATCATA
AAGGCTGGCATTAGAGTTCAATACGAGGTGGTTGACTTTTCGGAACTTCCAAATATTTACGACCAGATGGAGAAG
GGAACGATGAAAGGCCGAGCTGTGCTCAAGATCGGAAAGACGCTCTCAAGGGGCCCTGAGCGACAGTCAAGTCTC
TGCCGGGACCTACATTTCTCGCCAAAGCAGACAAATGGCATAACGGGCTTGACAGCTAAGGGAGCTGTATCAGGG
GCCCTTGAACGCGCCATTGAGCGGGCCGGGAGAGACTTTCGATCCGATACCGTGACTGTCCCTACCGAGGCCGTG
ATGGAGGCAATTGTCAATGCGTCAACCTTTGGGGATGATATTTACGACGAGGAAGGGGACGCAACAGTGAATGAG
TTCCAGGAGAAAATCAAAGCACTAACAGGCAAAGAGGCAGCGCTCTTTGTCGTATCCGGTACCCAAGGCAATCAG
ATCTGTCTGCGGACTCATTTGCACCAGCCACCTCATACAATTCTTCTTGACTACCGTGCTCACGTTCAAACCTGG
GAAACTGGAGCAATTCCTGTTCTGTCGCAGGCAACAGTGACAAGCGTTGAGCCGAAGAATGGTGTTCATTTGACC
CTGGAAGATGTGAAGGATCGGATTATTGAGGAAGGAAACTTCCACTTTCCACCTACGCGAGTTGTCTCCCTCGAA
AACACCCTGAGTGGCTCGATTCTCCCATTGAAAGACGCCAGAGAGATTTCGAACTATGTCCGCAGAGTTCGTGTG
CCGCCAGGCCGAGCCCCAATCGCCATGCATCTCGATGGAGCCCGGCTGCTGGAAGGTATAACTGCAGAAGGCGTA
ACAGCCAGGGAGTACCTTGACTGCTTCGACAGTGCTAGTATCTGCATTTCCAAGGGCTGTGGTGCTCCAATGGGC
AGCGTCATCGTTGGTACTCGCGAGTTCATCGACCGCGCGAAGTGGTTCCGGAAGATGTTTGGAGGCGCAACTCGA
CAGACGGGAATGATGGCCGCTGCTGCCATCGCTGCGATGGAGCACACTTTGCCCCTACTTCCGAAAGTGCATGCG
CTCACCCGGCGCGTGGCCGACTATCTGCATCGGATCGGGTACGAATTCCTCATGCCAGTGGATACCAACATGATT
GTCCTCGACTTGAAGAAGACTGGCATTACTGGAGATGATATTGTTTTCTACTGCAAGCAGCAGGGATTGTTGGTA
TTCCCTAACGGGCGGCTAGCCTTCCACCATCAGATATCGGACGACGGGGTTGCTCGGCTTCAGAGAGCGTTGTTG
GAACTGATTACGGATAAGAAGAGATACTAA
Transcript >Ani_SJS72_1|g5896.t1
ATGACTAGGCGGACACGAAGGAGTTGGATTGGTTGCTGCAGTCGGCTCGCAGGTGAACGGCCTTCGCATTGGAGA
CACCGTCGGAATACAGAACTTGCGGCGTGTGCGAGTTTTGCTCTACTGGGAGACAACCGCTCTGTCCTAAGCTTC
AGCTGTCGGGTGCGCATTCCGTCCGGAATTTCTCTAGAGGCCGCTGCCCCGGTTCTCTGTGCCGGAATTACCGTA
TACAAGGCCCTCAAAGAAAGTGAAGTCCAGCCAGGACAGATCATCGCCATTGTCGGCGCAGGCGGAGGACTGGGC
TCTCTGGCCTGCCAATATGCCAAGGCATGCGGACATAAGGTCCTTGCCTTATCGTCCGGGGCCGCCAAGAGGCAA
ATGTGTCTATACGATCTTGGAGCGGATTACTTTGTCGATTACAAGTCTCCGGACGTTGCGGAGGAGGTGAAGCGC
GTCACCGGCGGCGGACCGCATGCTGCGATGATAGTGTCATCCGTGGAGGAGCCTTTCCACCAGGCTACACAGTAC
ATTCGCCCGGGCGGAACAATCGTCGCTGTCGGTCTCCCACCTGGGAAAATCTGCACTGACCTCTTCCATATGATA
ACCCAGCGGATTAACATTAAGGGGTCCTACGTGGGGAATAGAGATGAAACCGAGGAAGCGCTTGCCATCATCATA
AAGGCTGGCATTAGAGTTCAATACGAGGTGGTTGACTTTTCGGAACTTCCAAATATTTACGACCAGATGGAGAAG
GGAACGATGAAAGGCCGAGCTGTGCTCAAGATCGGAAAGACGCTCTCAAGGGGCCCTGAGCGACAGTCAAGTCTC
TGCCGGGACCTACATTTCTCGCCAAAGCAGACAAATGGCATAACGGGCTTGACAGCTAAGGGAGCTGTATCAGGG
GCCCTTGAACGCGCCATTGAGCGGGCCGGGAGAGACTTTCGATCCGATACCGTGACTGTCCCTACCGAGGCCGTG
ATGGAGGCAATTGTCAATGCGTCAACCTTTGGGGATGATATTTACGACGAGGAAGGGGACGCAACAGTGAATGAG
TTCCAGGAGAAAATCAAAGCACTAACAGGCAAAGAGGCAGCGCTCTTTGTCGTATCCGGTACCCAAGGCAATCAG
ATCTGTCTGCGGACTCATTTGCACCAGCCACCTCATACAATTCTTCTTGACTACCGTGCTCACGTTCAAACCTGG
GAAACTGGAGCAATTCCTGTTCTGTCGCAGGCAACAGTGACAAGCGTTGAGCCGAAGAATGGTGTTCATTTGACC
CTGGAAGATGTGAAGGATCGGATTATTGAGGAAGGAAACTTCCACTTTCCACCTACGCGAGTTGTCTCCCTCGAA
AACACCCTGAGTGGCTCGATTCTCCCATTGAAAGACGCCAGAGAGATTTCGAACTATGTCCGCAGAGTTCGTGTG
CCGCCAGGCCGAGCCCCAATCGCCATGCATCTCGATGGAGCCCGGCTGCTGGAAGGTATAACTGCAGAAGGCGTA
ACAGCCAGGGAGTACCTTGACTGCTTCGACAGTGCTAGTATCTGCATTTCCAAGGGCTGTGGTGCTCCAATGGGC
AGCGTCATCGTTGGTACTCGCGAGTTCATCGACCGCGCGAAGTGGTTCCGGAAGATGTTTGGAGGCGCAACTCGA
CAGACGGGAATGATGGCCGCTGCTGCCATCGCTGCGATGGAGCACACTTTGCCCCTACTTCCGAAAGTGCATGCG
CTCACCCGGCGCGTGGCCGACTATCTGCATCGGATCGGGTACGAATTCCTCATGCCAGTGGATACCAACATGATT
GTCCTCGACTTGAAGAAGACTGGCATTACTGGAGATGATATTGTTTTCTACTGCAAGCAGCAGGGATTGTTGGTA
TTCCCTAACGGGCGGCTAGCCTTCCACCATCAGATATCGGACGACGGGGTTGCTCGGCTTCAGAGAGCGTTGTTG
GAACTGATTACGGATAAGAAGAGATACTAA
Gene >Ani_SJS72_1|g5896.t1
ATGACTAGGCGGACACGAAGGAGTTGGATTGGTTGCTGCAGTCGGCTCGCAGGTGAACGGCCTTCGCATTGGAGA
CACCGTCGGAATACAGGTATGATCTTTACGTATGTCTTCACCGAGATTCATAGAGTAATGGCATGCTAGTGGATT
AATAGAACTTGCGGCGTGTGCGAGTTTTGCTCTACTGGGAGACAACCGCTCTGTCCTAAGCTTCAGCTGTCGGGG
TATATGGTCGATGGGACCTTCCAACAGTATTGTATTTGCAAGGCTGACAATGCAGTGCGCATTCCGTCCGGAATT
TCTCTAGAGGCCGCTGCCCCGGTTTGTTTACTACTGTCCATTCCAAAAGGATGGTCTGACTGAATGACACGTCTA
GGTTCTCTGTGCCGGAATTACCGTATACAAGGCCCTCAAAGAAAGTGAAGTCCAGCCAGGACAGATCATCGGTAA
GCATGACATTACCCTTAGCGACAAATCTCTCACCACTGAATTATGCAACCAGCCATTGTCGGCGCAGGCGGAGGA
CTGGGCTCTCTGGCCTGCCAATATGCCAAGGCATGCGGACATAAGGTCCTTGCCTTATCGTCCGGGGCCGCCAAG
AGGCAAATGTGTCTATACGATCTTGGAGCGGATTACTTTGTCGATTACAAGTCTCCGGACGTTGCGGAGGAGGTG
AAGCGCGTCACCGGCGGCGGACCGCATGCTGCGATGATAGTGTCATCCGTGGAGGAGCCTTTCCACCAGGCTACA
CAGGTGATTTGAACGTCTCTATTAAACCCTGAACAGAAGCTGATATCTCCTCCAGTACATTCGCCCGGGCGGAAC
AATCGTCGCTGTCGGTCTCCCACCTGGGAAAATCTGCACTGACCTCTTCCATATGATAACCCAGCGGATTAACAT
TAAGGGGTCCTACGTGGGGAATAGAGATGAAACCGAGGAAGCGCTTGCCATCATCATAAAGGCTGGCATTAGAGT
TCAATACGAGGTGGTTGACTTTTCGGAACTTCCAAATATTTACGACCAGATGGAGAAGGGTATGTTTCAAATGCA
AAATATGCTAGTCCGGTATTAACATTGCCCAGGAACGATGAAAGGCCGAGCTGTGCTCAAGATCGGAAAGACGCT
CTCAAGGGGCCCTGAGCGACAGTCAAGTCTCTGCCGGGACCTACATTTCTCGCCAAAGCAGACAAATGGCATAAC
GGGCTTGACAGCTAAGGGAGCTGTATCAGGGGCCCTTGAACGCGCCATTGAGCGGGCCGGGAGAGACTTTCGATC
CGATACCGTGACTGTCCCTACCGAGGCCGTGATGGAGGTATGTTTCATCTGGCGGATCTGAAAATTGTCAAATAC
TTACTATTTCAGGCAATTGTCAATGCGTCAACCTTTGGGGATGATATTTACGACGAGGAAGGGGACGCAACAGTG
AATGAGTTCCAGGAGAAAATCAAAGCACTAACAGGCAAAGAGGCAGCGCTCTTTGTCGTATCCGGTACCCAAGGC
AATCAGATCTGTCTGCGGACTCATTTGCACCAGCCACCTCATACAATTCTTCTTGACTACCGTGCTCACGTTCAA
ACCTGGGAAACTGGAGCAATTCCTGTTCTGTCGCAGGCAACAGTGACAAGCGTTGAGCCGAAGAATGGTGTTCAT
TTGACCCTGGAAGATGTGAAGGATCGGATTATTGAGGAAGGAAACTGTAACAAGTCTCGCTCTATCACAGGTTCC
ATGTTTTGCTGACAACCCTTGCAGTCCACTTTCCACCTACGCGAGTTGTCTCCCTCGAAAACACCCTGAGTGGCT
CGATTCTCCCATTGAAAGACGCCAGAGAGATTTCGAACTATGTCCGCAGAGTTCGTGTGCCGCCAGGCCGAGCCC
CAATCGCCATGCATCTCGATGGAGCCCGGCTGCTGGAAGGTATAACTGCAGAAGGCGTAACAGCCAGGGAGTACC
TTGACTGCTTCGACAGTGCTAGTATCTGCATTTCCAAGGGCTGTGGTGCTCCAATGGGCAGCGTCATCGTTGGTA
CTCGCGAGTTCATCGACCGCGCGAAGTGGTTCCGGAAGATGTTTGGAGGCGCAACTCGACAGGTAAATTCCGTAC
AGTACAAACCGGTCAGAAGTATTTATACTGATAAATCTAGACGGGAATGATGGCCGCTGCTGCCATCGCTGCGAT
GGAGCACACTTTGCCCCTACTTCCGAAAGTGCATGCGCTCACCCGGCGCGTGGCCGACTATCTGCATCGGATCGG
GTACGAATTCCTCATGCCAGTGGATACCAACATGATTGTCCTCGACTTGAAGAAGACTGGCATTACTGGAGATGA
TATTGTTTTCTACTGCAAGCAGCAGGGATTGTTGGTATTCCCTAACGGGCGGCTAGCCTTCCACCATCAGATATC
GGACGACGGGGTTGCTCGGCTTCAGAGAGCGTTGTTGGAACTGATTACGGATAAGAAGAGATACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail