Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g580.t1
Gene name
Locationscaffold_003:10438..11764
Strand-
Gene length (bp)1326
Transcript length (bp)996
Coding sequence length (bp)996
Protein length (aa) 332

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01095 Pectinesterase Pectinesterase 1.4E-51 28 297

GO

GO Term Description Terminal node
GO:0042545 cell wall modification Yes
GO:0030599 pectinesterase activity Yes
GO:0009987 cellular process No
GO:0071555 cell wall organization No
GO:0071840 cellular component organization or biogenesis No
GO:0003824 catalytic activity No
GO:0052689 carboxylic ester hydrolase activity No
GO:0045229 external encapsulating structure organization No
GO:0071554 cell wall organization or biogenesis No
GO:0003674 molecular_function No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0016043 cellular component organization No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g580.t1
MVKSILASVFFAATALAASRMTAPSGAIVVAKSGGDYDTISAAVDALSTTSTETQTIFIEEGSYDEQVYIPALSG
KLIVYGQTEDTTTYTSNLVNITHAIALADVDNDDETATLRNYAEGSAIYNLNIANTCGQACHQALAVSAYATEQG
YYACQFTGYQDTLLAETGYQVYAGTYIEGAVDFIFGQHARAWFHECDIRVLEGPSSASITANGRSSESDDSYYVI
HKSTVAAADGNDVSSGTYYLGRPWSQYARVCFQKTSMTDVINHLGWTEWSTSTPNTENVTFVEYGNTGAGSKGPR
ANFSSELTEPISISTLLGSDWEDWVDTSYIN*
Coding >Ani_SJS72_1|g580.t1
ATGGTTAAGTCAATTCTTGCATCCGTTTTCTTTGCGGCGACTGCGCTGGCCGCGAGCCGCATGACGGCTCCTTCC
GGTGCGATTGTCGTTGCCAAGTCCGGAGGTGACTACGACACGATCAGTGCTGCCGTTGATGCTCTGAGCACCACT
TCGACCGAGACCCAGACTATCTTCATTGAGGAGGGATCCTACGACGAGCAGGTGTACATTCCCGCTCTCAGTGGA
AAGCTGATCGTCTACGGTCAGACTGAGGACACCACCACCTACACCAGCAACCTGGTCAACATCACCCACGCCATT
GCCTTAGCCGATGTCGACAATGACGATGAGACTGCAACCCTCCGTAACTACGCCGAGGGCTCGGCCATCTACAAC
CTAAACATTGCCAACACCTGCGGTCAGGCCTGCCACCAGGCTCTCGCCGTGAGTGCCTATGCCACCGAGCAGGGA
TACTACGCCTGCCAGTTCACCGGATACCAGGACACCCTTCTGGCTGAGACCGGTTACCAGGTTTACGCCGGAACC
TACATCGAGGGTGCCGTTGACTTTATTTTCGGACAGCACGCCCGCGCTTGGTTCCACGAGTGCGACATCCGCGTT
CTCGAGGGCCCCAGCTCCGCCTCCATCACCGCCAACGGCCGCTCCTCCGAGTCCGACGACTCCTACTACGTGATC
CACAAGTCCACCGTCGCTGCTGCTGATGGCAACGATGTTTCCTCGGGCACCTACTATCTTGGCCGCCCCTGGTCC
CAGTACGCTCGCGTCTGCTTCCAGAAGACCTCCATGACCGATGTGATCAACCACCTCGGCTGGACTGAGTGGTCG
ACCTCCACCCCCAACACTGAGAATGTCACCTTTGTTGAATACGGCAACACCGGTGCTGGTTCTAAGGGCCCCCGT
GCTAACTTCTCTTCTGAGCTCACCGAGCCCATCTCTATCTCTACCCTTCTGGGCTCTGACTGGGAGGACTGGGTT
GATACCAGCTACATCAACTAA
Transcript >Ani_SJS72_1|g580.t1
ATGGTTAAGTCAATTCTTGCATCCGTTTTCTTTGCGGCGACTGCGCTGGCCGCGAGCCGCATGACGGCTCCTTCC
GGTGCGATTGTCGTTGCCAAGTCCGGAGGTGACTACGACACGATCAGTGCTGCCGTTGATGCTCTGAGCACCACT
TCGACCGAGACCCAGACTATCTTCATTGAGGAGGGATCCTACGACGAGCAGGTGTACATTCCCGCTCTCAGTGGA
AAGCTGATCGTCTACGGTCAGACTGAGGACACCACCACCTACACCAGCAACCTGGTCAACATCACCCACGCCATT
GCCTTAGCCGATGTCGACAATGACGATGAGACTGCAACCCTCCGTAACTACGCCGAGGGCTCGGCCATCTACAAC
CTAAACATTGCCAACACCTGCGGTCAGGCCTGCCACCAGGCTCTCGCCGTGAGTGCCTATGCCACCGAGCAGGGA
TACTACGCCTGCCAGTTCACCGGATACCAGGACACCCTTCTGGCTGAGACCGGTTACCAGGTTTACGCCGGAACC
TACATCGAGGGTGCCGTTGACTTTATTTTCGGACAGCACGCCCGCGCTTGGTTCCACGAGTGCGACATCCGCGTT
CTCGAGGGCCCCAGCTCCGCCTCCATCACCGCCAACGGCCGCTCCTCCGAGTCCGACGACTCCTACTACGTGATC
CACAAGTCCACCGTCGCTGCTGCTGATGGCAACGATGTTTCCTCGGGCACCTACTATCTTGGCCGCCCCTGGTCC
CAGTACGCTCGCGTCTGCTTCCAGAAGACCTCCATGACCGATGTGATCAACCACCTCGGCTGGACTGAGTGGTCG
ACCTCCACCCCCAACACTGAGAATGTCACCTTTGTTGAATACGGCAACACCGGTGCTGGTTCTAAGGGCCCCCGT
GCTAACTTCTCTTCTGAGCTCACCGAGCCCATCTCTATCTCTACCCTTCTGGGCTCTGACTGGGAGGACTGGGTT
GATACCAGCTACATCAACTAA
Gene >Ani_SJS72_1|g580.t1
ATGGTTAAGTCAATTCTTGCATCCGTTTTCTTTGCGGCGACTGCGCTGGCCGCGAGCCGCATGACGGCTCCTTCC
GGTGCGATTGTCGTTGCCAAGTCCGGAGGTGACTACGACACGGTGAGCATCTAGACTGTCGATCGTGTTGCAGAT
GTGTGGCTGATAGTGTCTTGTTGAACAGATCAGTGCTGCCGTTGATGCTCTGAGCACCACTTCGACCGAGACCCA
GACTATCTTCATTGAGGAGGGATCCTACGACGAGCAGGTGTACATTCCCGCTCTCAGTGGAAAGCTGATCGTCTA
CGGTCAGACTGAGGAGTACGTTGTCAGTTGCGTATAGAAATTCAAGGATACTAATGAAGGTTTAGCACCACCACC
TACACCAGCAACCTGGTCAACATCACCCACGCCATTGCCTTAGCCGATGTCGACAATGACGATGAGACTGGTCGG
TCCACACACTCTGGAAAATGTCCGTGAACTCGCTAACAATAAGTAGCAACCCTCCGTAACTACGCCGAGGGCTCG
GCCATCTACAACCTAAACATTGCCAACACCTGCGGTCAGGCCTGCCACCAGGCTCTCGCCGTGAGTGCCTATGCC
ACCGAGCAGGGATACTACGCCTGCCAGTTCACCGGATACCAGGGTAGGACCAATTTCAGATATGCCAACCGACAG
TGATTAATCTCTACTATAGACACCCTTCTGGCTGAGACCGGTTACCAGGTTTACGCCGGAACCTACATCGAGGGT
GCCGTGTATGTCCCTACCTTAATACCTTCGAAAGAAGTGAATCCAACTAACGTACAACCAGTGACTTTATTTTCG
GACAGCACGCCCGCGCTTGGTTCCACGAGTGCGACATCCGCGTTCTCGAGGGCCCCAGCTCCGCCTCCATCACCG
CCAACGGCCGCTCCTCCGAGTCCGACGACTCCTACTACGTGATCCACAAGTCCACCGTCGCTGCTGCTGATGGCA
ACGATGTTTCCTCGGGCACCTACTATCTTGGTATGCCACTGGTCTAGAACTGTCCACGGAGCCACTAGCCCACTA
ACGAATATTATCACAGGCCGCCCCTGGTCCCAGTACGCTCGCGTCTGCTTCCAGAAGACCTCCATGACCGATGTG
ATCAACCACCTCGGCTGGACTGAGTGGTCGACCTCCACCCCCAACACTGAGAATGTCACCTTTGTTGAATACGGC
AACACCGGTGCTGGTTCTAAGGGCCCCCGTGCTAACTTCTCTTCTGAGCTCACCGAGCCCATCTCTATCTCTACC
CTTCTGGGCTCTGACTGGGAGGACTGGGTTGATACCAGCTACATCAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail