Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g5698.t1
Gene name
Locationscaffold_040:80151..81934
Strand-
Gene length (bp)1783
Transcript length (bp)1506
Coding sequence length (bp)1506
Protein length (aa) 502

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.7E-39 38 427
PF00083 Sugar_tr Sugar (and other) transporter 3.3E-11 67 213

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.5

Transmembrane Domains

Domain # Start End Length
1 33 55 22
2 70 92 22
3 99 119 20
4 129 151 22
5 158 180 22
6 190 209 19
7 283 305 22
8 325 347 22
9 370 392 22
10 397 419 22
11 431 453 22
12 463 485 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g5698.t1
MPTLSHRGLQLIPVPTDDPGDPLRWPSWLKLSVILSTSLVNFVSNMGGAGLSVAVPVLMQQLQRSQAEVTQLLTL
NFLFLGIGNIFWVPLAVKFGKRASIISSMLLQAGALVWCAVATGYDSLLGARCVLGFAAAAGESIVPEIVADIFF
VHERATMMAIYVVLISGGSAVGPLIGGFMVEYASGTWRSYMWLCFALASFNIVLLVFLFPESTFKRPEPSQAQEL
QPVAEHKETTSSFIENASAAAPEDSYTTNTPPFKGVLRPFHYNKDASFFKAVISPLKLLVHPSVCWGIFTYGISL
SPQIIMIFNFSALLEAPPYFFRSEYVGLMEIAAIVGFLLACYGGGYLSDTVNRIIAQRSSSSSIRPEQRLISLIP
GMAIGPAGCILLAFACGHKLHWAAIAVGFGMVSFGTAYTPNIALTYIVHLHQQDAANCLVSISLVKNLVAFTFLY
VAVDWVEREGYVQVFMIMFMLNVLALLCAVPLYFLGRRKDLNVYNGMEGRA*
Coding >Ani_SJS72_1|g5698.t1
ATGCCTACCCTGAGCCATCGGGGTCTTCAATTGATCCCAGTCCCTACGGATGATCCGGGTGATCCTCTTCGCTGG
CCCAGCTGGCTCAAATTGTCTGTCATACTCTCGACGTCCTTGGTCAATTTTGTCTCCAACATGGGTGGTGCTGGA
TTGTCCGTTGCCGTCCCGGTCTTGATGCAGCAGCTCCAGCGTTCCCAAGCAGAGGTAACCCAGCTACTCACGCTT
AACTTTCTGTTCCTGGGCATCGGCAATATCTTCTGGGTCCCGCTTGCGGTCAAGTTTGGCAAACGTGCATCAATT
ATATCCTCGATGTTGCTTCAGGCAGGGGCCCTGGTGTGGTGTGCGGTAGCTACGGGCTATGACAGCCTCTTGGGC
GCAAGATGCGTTCTTGGATTTGCTGCTGCTGCTGGCGAAAGTATCGTACCCGAGATCGTTGCTGATATATTCTTC
GTCCACGAGCGTGCTACGATGATGGCAATCTATGTTGTCTTGATCTCTGGAGGCTCAGCTGTTGGCCCCTTAATT
GGAGGTTTTATGGTAGAGTACGCCTCGGGCACGTGGCGGTCATACATGTGGCTTTGCTTCGCGCTCGCCAGTTTC
AATATAGTGCTCTTGGTCTTCCTCTTCCCGGAATCGACCTTCAAGCGACCGGAACCTTCTCAGGCACAGGAGTTA
CAGCCCGTCGCAGAACACAAAGAGACTACGAGTTCATTCATCGAGAATGCCTCAGCTGCAGCTCCAGAGGACTCC
TATACCACCAACACGCCCCCATTTAAGGGTGTCCTTCGGCCGTTCCATTACAATAAGGATGCCAGCTTTTTCAAG
GCAGTGATCTCGCCTCTCAAGCTGTTGGTTCATCCGTCGGTCTGTTGGGGCATCTTTACCTACGGCATATCGCTA
AGTCCGCAAATCATTATGATCTTTAACTTCTCCGCTCTCCTAGAAGCGCCGCCATACTTCTTCCGCTCCGAGTAT
GTCGGTCTCATGGAAATCGCCGCTATTGTGGGATTCCTACTAGCATGCTACGGCGGTGGCTACCTATCCGATACC
GTAAACAGAATTATTGCCCAACGCAGCAGCAGTAGCAGCATCCGCCCCGAACAACGCCTCATCTCTCTCATCCCA
GGAATGGCCATCGGGCCGGCAGGCTGTATCCTGCTCGCGTTTGCCTGCGGCCACAAACTCCACTGGGCCGCCATC
GCGGTTGGCTTCGGAATGGTCTCGTTTGGGACCGCGTATACACCCAACATCGCTCTTACGTACATCGTGCACTTG
CATCAACAAGATGCCGCGAACTGCCTTGTCTCAATTAGCTTGGTCAAAAACCTGGTGGCATTCACGTTTCTGTAT
GTTGCTGTGGACTGGGTTGAGAGGGAGGGTTACGTGCAGGTTTTTATGATTATGTTTATGTTGAATGTTTTGGCT
CTTCTCTGTGCGGTCCCGTTGTACTTTTTGGGACGGAGGAAGGACTTGAACGTATATAATGGGATGGAGGGGCGT
GCGTAA
Transcript >Ani_SJS72_1|g5698.t1
ATGCCTACCCTGAGCCATCGGGGTCTTCAATTGATCCCAGTCCCTACGGATGATCCGGGTGATCCTCTTCGCTGG
CCCAGCTGGCTCAAATTGTCTGTCATACTCTCGACGTCCTTGGTCAATTTTGTCTCCAACATGGGTGGTGCTGGA
TTGTCCGTTGCCGTCCCGGTCTTGATGCAGCAGCTCCAGCGTTCCCAAGCAGAGGTAACCCAGCTACTCACGCTT
AACTTTCTGTTCCTGGGCATCGGCAATATCTTCTGGGTCCCGCTTGCGGTCAAGTTTGGCAAACGTGCATCAATT
ATATCCTCGATGTTGCTTCAGGCAGGGGCCCTGGTGTGGTGTGCGGTAGCTACGGGCTATGACAGCCTCTTGGGC
GCAAGATGCGTTCTTGGATTTGCTGCTGCTGCTGGCGAAAGTATCGTACCCGAGATCGTTGCTGATATATTCTTC
GTCCACGAGCGTGCTACGATGATGGCAATCTATGTTGTCTTGATCTCTGGAGGCTCAGCTGTTGGCCCCTTAATT
GGAGGTTTTATGGTAGAGTACGCCTCGGGCACGTGGCGGTCATACATGTGGCTTTGCTTCGCGCTCGCCAGTTTC
AATATAGTGCTCTTGGTCTTCCTCTTCCCGGAATCGACCTTCAAGCGACCGGAACCTTCTCAGGCACAGGAGTTA
CAGCCCGTCGCAGAACACAAAGAGACTACGAGTTCATTCATCGAGAATGCCTCAGCTGCAGCTCCAGAGGACTCC
TATACCACCAACACGCCCCCATTTAAGGGTGTCCTTCGGCCGTTCCATTACAATAAGGATGCCAGCTTTTTCAAG
GCAGTGATCTCGCCTCTCAAGCTGTTGGTTCATCCGTCGGTCTGTTGGGGCATCTTTACCTACGGCATATCGCTA
AGTCCGCAAATCATTATGATCTTTAACTTCTCCGCTCTCCTAGAAGCGCCGCCATACTTCTTCCGCTCCGAGTAT
GTCGGTCTCATGGAAATCGCCGCTATTGTGGGATTCCTACTAGCATGCTACGGCGGTGGCTACCTATCCGATACC
GTAAACAGAATTATTGCCCAACGCAGCAGCAGTAGCAGCATCCGCCCCGAACAACGCCTCATCTCTCTCATCCCA
GGAATGGCCATCGGGCCGGCAGGCTGTATCCTGCTCGCGTTTGCCTGCGGCCACAAACTCCACTGGGCCGCCATC
GCGGTTGGCTTCGGAATGGTCTCGTTTGGGACCGCGTATACACCCAACATCGCTCTTACGTACATCGTGCACTTG
CATCAACAAGATGCCGCGAACTGCCTTGTCTCAATTAGCTTGGTCAAAAACCTGGTGGCATTCACGTTTCTGTAT
GTTGCTGTGGACTGGGTTGAGAGGGAGGGTTACGTGCAGGTTTTTATGATTATGTTTATGTTGAATGTTTTGGCT
CTTCTCTGTGCGGTCCCGTTGTACTTTTTGGGACGGAGGAAGGACTTGAACGTATATAATGGGATGGAGGGGCGT
GCGTAA
Gene >Ani_SJS72_1|g5698.t1
ATGCCTACCCTGAGCCATCGGGGTCTTCAATTGATCCCAGTCCCTACGGATGATCCGGGTGATCCTCTTCGCTGG
CCCAGCTGGCTCAAATTGTCTGTCATACTCTCGACGTCCTTGGTCAATTTTGTCTCCAACATGGGTGGTGCTGGA
TTGTCCGTTGCCGTCCCGGTCTTGATGCAGCAGCTCCAGCGTTCCCAAGCAGAGGTAACCCAGCTACTCACGGTA
CGCAATTCATATAACCTGGAAACCCACGGGTATAAGCAGAGTCTGCTGACTTATTCTGGGTAGCTTAACTTTCTG
TTCCTGGGCATCGGCAATATCTTCTGGGTCCCGCTTGCGGTCAAGTTTGGCAAACGTGCATCAATTATATCCTCG
ATGTTGCTTCAGGCAGGGGCCCTGGTGTGGTGTGCGGTAGCTACGGGCTATGACAGCCTCTTGGGCGCAAGATGC
GTTCTTGGATTTGCTGCTGCTGCTGGCGAAGTAAGAAGCCGCTCCCATAAAGATTCACCTAGTCTTATCACCTGG
ATACGCCGAATTGACGTTGGATGTTCTATAGAGTATCGTACCCGAGATCGTTGCTGATATATTCTTCGTCCACGA
GCGTGCTACGATGATGGCAATGTGAGATTTTGGACCCTTTCATAGTACACCACCTGTTGAGACTTTTCCTGATTT
GATATAGCTATGTTGTCTTGATCTCTGGAGGCTCAGCTGTTGGCCCCTTAATTGGAGGTTTTATGGTAGAGTACG
CCTCGGGCACGTGGCGGTCATACATGTGGCTTTGCTTCGCGCTCGCCAGTTTCAATATAGTGCTCTTGGTCTTCC
TCTTCCCGGAATCGACCTTCAAGCGACCGGAACCTTCTCAGGCACAGGAGTTACAGCCCGTCGCAGAACACAAAG
AGACTACGAGTTCATTCATCGAGAATGCCTCAGCTGCAGCTCCAGAGGACTCCTATACCACCAACACGCCCCCAT
TTAAGGGTGTCCTTCGGCCGTTCCATTACAATAAGGATGCCAGCTTTTTCAAGGCAGTGATCTCGCCTCTCAAGC
TGTTGGTTCATCCGTCGGTCTGTTGGGGCATCTTTACCTACGGCATATCGCTAAGTCCGCAAATCATTATGATGT
ACGTGCTCCTATGAGAAACTCTGTCGCGGAAAAAGACCAGCGCCCGTGCTAATAACAGATAAATCATAATAGCTT
TAACTTCTCCGCTCTCCTAGAAGCGCCGCCATACTTCTTCCGCTCCGAGTATGTCGGTCTCATGGAAATCGCCGC
TATTGTGGGATTCCTACTAGCATGCTACGGCGGTGGCTACCTATCCGATACCGTAAACAGAATTATTGCCCAACG
CAGCAGCAGTAGCAGCATCCGCCCCGAACAACGCCTCATCTCTCTCATCCCAGGAATGGCCATCGGGCCGGCAGG
CTGTATCCTGCTCGCGTTTGCCTGCGGCCACAAACTCCACTGGGCCGCCATCGCGGTTGGCTTCGGAATGGTCTC
GTTTGGGACCGCGTATACACCCAACATCGCTCTTACGTACATCGTGCACTTGCATCAACAAGATGCCGCGAACTG
CCTTGTCTCAATTAGCTTGGTCAAAAACCTGGTGGCATTCACGTTTCTGTATGTTGCTGTGGACTGGGTTGAGAG
GGAGGGTTACGTGCAGGTTTTTATGATTATGTTTATGTTGAATGTTTTGGCTCTTCTCTGTGCGGTCCCGTTGTA
CTTTTTGGGACGGAGGAAGGACTTGAACGTATATAATGGGATGGAGGGGCGTGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail