Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g5557.t1
Gene name
Locationscaffold_038:211570..213287
Strand-
Gene length (bp)1717
Transcript length (bp)1653
Coding sequence length (bp)1653
Protein length (aa) 551

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22
2 64 86 22
3 110 132 22
4 145 167 22
5 195 217 22
6 230 252 22
7 262 284 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g5557.t1
MNVQWMLESRGIFSDIPPDPRTKEQNNPTLLVSWWATAFSVAIIVVRVCGRYIRTERFFREDKVMMLSVIPLLIR
MACVHVVLIWGTNNTKTVGLSAEDIHHRVIGSKFVLVARIFYAIFIWIAKFTVCEFLKRVAGKIWRRSLRIFLKF
IYYFLASTLLAVIIATLAECQPFDHYWQVVPDPGPRCRLGYANLITMGSCDVMTDLLLVSFPIPFIVMTHMPLKR
KISLVILFALSLILVGITCYRVPSVIWNDGSQQYRSLVASLEILAATAVSNAVIIGSFVRDRGAKKNKFKKAQGS
ASVSESMDHSSVRRQTITHHQWGSDSDLAADLGIRLDPSLCSADTKTPRPAPIAMPIHPLTARAGTLDPNWSFNQ
RSGGSEDDQASSTGSLDIKVSPHEYIETNKTPRKSSSTDTTNLRIFDVGSLLNNHPPTSPTSAPTPQYSHYASGA
SNAFVQDTGGPARTLHLNTTSSSIPSHQLPLPSSPNFSRPGGLRSNSHSSSNRRRGSSVHFSDPPDSPVPSYRSQ
ADVSAPIMEGNEVELQDVGRLLSRR*
Coding >Ani_SJS72_1|g5557.t1
ATGAATGTACAGTGGATGCTTGAATCGCGTGGGATTTTTTCCGATATCCCTCCTGATCCCCGGACCAAGGAGCAA
AATAATCCCACTCTGCTCGTGAGCTGGTGGGCTACGGCTTTTTCGGTAGCCATCATCGTTGTCCGGGTTTGTGGT
CGTTATATTCGGACCGAGCGTTTCTTCCGGGAAGATAAGGTGATGATGCTGAGCGTCATCCCGTTATTGATTCGC
ATGGCATGCGTGCATGTCGTCTTGATCTGGGGTACCAATAATACCAAGACCGTGGGCTTGTCTGCCGAAGACATC
CACCATAGAGTCATTGGCAGTAAGTTCGTTCTTGTTGCGCGCATCTTCTATGCTATCTTCATCTGGATAGCCAAG
TTCACAGTATGCGAATTTCTCAAGCGAGTGGCAGGCAAGATCTGGCGACGTTCCCTCCGAATCTTCCTCAAATTC
ATCTACTACTTCCTGGCATCGACATTGTTGGCAGTGATCATAGCTACTCTCGCTGAATGCCAGCCCTTCGACCAT
TACTGGCAAGTTGTGCCCGACCCAGGTCCACGTTGTCGCCTCGGCTATGCCAACCTGATAACAATGGGATCCTGC
GATGTGATGACCGATCTGCTCCTAGTCTCCTTCCCGATTCCTTTCATCGTGATGACTCACATGCCTCTGAAACGC
AAAATCTCCCTCGTGATCCTGTTCGCTCTGTCTCTGATTCTGGTTGGAATCACATGCTATCGAGTGCCCTCAGTC
ATCTGGAACGATGGCTCACAGCAATACCGATCGCTTGTCGCGTCTTTGGAAATCTTAGCCGCCACGGCGGTCTCA
AACGCTGTCATCATAGGCTCATTCGTGCGTGATAGAGGTGCCAAAAAGAACAAATTCAAAAAGGCTCAAGGATCA
GCCTCCGTCAGCGAAAGCATGGATCACAGCTCCGTGCGACGTCAAACCATCACCCACCACCAGTGGGGAAGTGAT
TCCGATCTTGCTGCAGATCTGGGTATTCGACTGGACCCGTCATTATGTTCCGCAGACACGAAAACGCCCCGTCCT
GCACCTATTGCGATGCCGATCCATCCACTGACAGCCCGTGCGGGAACTTTAGACCCCAACTGGTCCTTCAACCAG
CGCTCTGGTGGCAGTGAAGACGACCAAGCCTCCAGCACGGGAAGCTTGGACATCAAAGTCAGTCCGCACGAGTAC
ATTGAAACCAACAAGACACCGCGCAAATCATCCTCGACAGATACCACCAACCTCCGGATCTTCGATGTCGGTAGC
CTTCTAAACAATCATCCCCCGACCTCTCCCACCAGCGCCCCAACTCCGCAATATTCACATTATGCCAGCGGGGCA
AGCAACGCCTTCGTTCAGGATACTGGAGGACCAGCCCGAACCCTTCATCTCAACACCACCTCCTCATCCATCCCG
TCCCACCAACTACCTCTCCCCTCCTCGCCCAACTTCTCCCGCCCAGGAGGTCTGCGCAGTAACTCCCATTCGTCT
TCTAATCGCCGTCGCGGCTCCAGTGTCCACTTCAGTGATCCTCCGGACTCACCCGTCCCTTCTTACCGCTCTCAG
GCTGATGTGTCAGCGCCTATCATGGAAGGGAACGAGGTTGAGCTCCAGGATGTGGGGAGATTGCTGTCCAGACGG
TGA
Transcript >Ani_SJS72_1|g5557.t1
ATGAATGTACAGTGGATGCTTGAATCGCGTGGGATTTTTTCCGATATCCCTCCTGATCCCCGGACCAAGGAGCAA
AATAATCCCACTCTGCTCGTGAGCTGGTGGGCTACGGCTTTTTCGGTAGCCATCATCGTTGTCCGGGTTTGTGGT
CGTTATATTCGGACCGAGCGTTTCTTCCGGGAAGATAAGGTGATGATGCTGAGCGTCATCCCGTTATTGATTCGC
ATGGCATGCGTGCATGTCGTCTTGATCTGGGGTACCAATAATACCAAGACCGTGGGCTTGTCTGCCGAAGACATC
CACCATAGAGTCATTGGCAGTAAGTTCGTTCTTGTTGCGCGCATCTTCTATGCTATCTTCATCTGGATAGCCAAG
TTCACAGTATGCGAATTTCTCAAGCGAGTGGCAGGCAAGATCTGGCGACGTTCCCTCCGAATCTTCCTCAAATTC
ATCTACTACTTCCTGGCATCGACATTGTTGGCAGTGATCATAGCTACTCTCGCTGAATGCCAGCCCTTCGACCAT
TACTGGCAAGTTGTGCCCGACCCAGGTCCACGTTGTCGCCTCGGCTATGCCAACCTGATAACAATGGGATCCTGC
GATGTGATGACCGATCTGCTCCTAGTCTCCTTCCCGATTCCTTTCATCGTGATGACTCACATGCCTCTGAAACGC
AAAATCTCCCTCGTGATCCTGTTCGCTCTGTCTCTGATTCTGGTTGGAATCACATGCTATCGAGTGCCCTCAGTC
ATCTGGAACGATGGCTCACAGCAATACCGATCGCTTGTCGCGTCTTTGGAAATCTTAGCCGCCACGGCGGTCTCA
AACGCTGTCATCATAGGCTCATTCGTGCGTGATAGAGGTGCCAAAAAGAACAAATTCAAAAAGGCTCAAGGATCA
GCCTCCGTCAGCGAAAGCATGGATCACAGCTCCGTGCGACGTCAAACCATCACCCACCACCAGTGGGGAAGTGAT
TCCGATCTTGCTGCAGATCTGGGTATTCGACTGGACCCGTCATTATGTTCCGCAGACACGAAAACGCCCCGTCCT
GCACCTATTGCGATGCCGATCCATCCACTGACAGCCCGTGCGGGAACTTTAGACCCCAACTGGTCCTTCAACCAG
CGCTCTGGTGGCAGTGAAGACGACCAAGCCTCCAGCACGGGAAGCTTGGACATCAAAGTCAGTCCGCACGAGTAC
ATTGAAACCAACAAGACACCGCGCAAATCATCCTCGACAGATACCACCAACCTCCGGATCTTCGATGTCGGTAGC
CTTCTAAACAATCATCCCCCGACCTCTCCCACCAGCGCCCCAACTCCGCAATATTCACATTATGCCAGCGGGGCA
AGCAACGCCTTCGTTCAGGATACTGGAGGACCAGCCCGAACCCTTCATCTCAACACCACCTCCTCATCCATCCCG
TCCCACCAACTACCTCTCCCCTCCTCGCCCAACTTCTCCCGCCCAGGAGGTCTGCGCAGTAACTCCCATTCGTCT
TCTAATCGCCGTCGCGGCTCCAGTGTCCACTTCAGTGATCCTCCGGACTCACCCGTCCCTTCTTACCGCTCTCAG
GCTGATGTGTCAGCGCCTATCATGGAAGGGAACGAGGTTGAGCTCCAGGATGTGGGGAGATTGCTGTCCAGACGG
TGA
Gene >Ani_SJS72_1|g5557.t1
ATGAATGTACAGTGGATGCTTGAATCGCGTGGGATTTTTTCCGATATCCCTCCTGATCCCCGGACCAAGGAGCAA
AATAATCCCACTCTGCTCGTGAGCTGGTGGGCTACGGCTTTTTCGGTAGCCATCATCGTTGTCCGGGTTTGTGGT
CGTTATATTCGGACCGAGCGTTTCTTCCGGGAAGATAAGGTGATGATGCTGAGCGTCATCCCGTTATTGATTCGC
ATGGCATGCGTGCATGTCGTCTTGATCTGGGGTACCAATAATACCAAGACCGTGGGCTTGTCTGCCGAAGACATC
CACCATAGAGTCATTGGCAGTAAGTTCGTTCTTGTTGCGCGCATCTTCTATGCTATCTTGTAAGTCCTCCCTCTT
CTCGCCGGGTGTTTTTGGGACCAGCTCTAACCGTCCTCATGCGCTTAGCATCTGGATAGCCAAGTTCACAGTATG
CGAATTTCTCAAGCGAGTGGCAGGCAAGATCTGGCGACGTTCCCTCCGAATCTTCCTCAAATTCATCTACTACTT
CCTGGCATCGACATTGTTGGCAGTGATCATAGCTACTCTCGCTGAATGCCAGCCCTTCGACCATTACTGGCAAGT
TGTGCCCGACCCAGGTCCACGTTGTCGCCTCGGCTATGCCAACCTGATAACAATGGGATCCTGCGATGTGATGAC
CGATCTGCTCCTAGTCTCCTTCCCGATTCCTTTCATCGTGATGACTCACATGCCTCTGAAACGCAAAATCTCCCT
CGTGATCCTGTTCGCTCTGTCTCTGATTCTGGTTGGAATCACATGCTATCGAGTGCCCTCAGTCATCTGGAACGA
TGGCTCACAGCAATACCGATCGCTTGTCGCGTCTTTGGAAATCTTAGCCGCCACGGCGGTCTCAAACGCTGTCAT
CATAGGCTCATTCGTGCGTGATAGAGGTGCCAAAAAGAACAAATTCAAAAAGGCTCAAGGATCAGCCTCCGTCAG
CGAAAGCATGGATCACAGCTCCGTGCGACGTCAAACCATCACCCACCACCAGTGGGGAAGTGATTCCGATCTTGC
TGCAGATCTGGGTATTCGACTGGACCCGTCATTATGTTCCGCAGACACGAAAACGCCCCGTCCTGCACCTATTGC
GATGCCGATCCATCCACTGACAGCCCGTGCGGGAACTTTAGACCCCAACTGGTCCTTCAACCAGCGCTCTGGTGG
CAGTGAAGACGACCAAGCCTCCAGCACGGGAAGCTTGGACATCAAAGTCAGTCCGCACGAGTACATTGAAACCAA
CAAGACACCGCGCAAATCATCCTCGACAGATACCACCAACCTCCGGATCTTCGATGTCGGTAGCCTTCTAAACAA
TCATCCCCCGACCTCTCCCACCAGCGCCCCAACTCCGCAATATTCACATTATGCCAGCGGGGCAAGCAACGCCTT
CGTTCAGGATACTGGAGGACCAGCCCGAACCCTTCATCTCAACACCACCTCCTCATCCATCCCGTCCCACCAACT
ACCTCTCCCCTCCTCGCCCAACTTCTCCCGCCCAGGAGGTCTGCGCAGTAACTCCCATTCGTCTTCTAATCGCCG
TCGCGGCTCCAGTGTCCACTTCAGTGATCCTCCGGACTCACCCGTCCCTTCTTACCGCTCTCAGGCTGATGTGTC
AGCGCCTATCATGGAAGGGAACGAGGTTGAGCTCCAGGATGTGGGGAGATTGCTGTCCAGACGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail