Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g549.t1
Gene name
Locationscaffold_002:715084..716512
Strand-
Gene length (bp)1428
Transcript length (bp)1428
Coding sequence length (bp)1428
Protein length (aa) 476

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09924 LPG_synthase_C Phosphatidylglycerol lysyltransferase, C-terminal 4.8E-24 137 439

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 445 467 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g549.t1
MTSSSPRKQKKSQQSSTKVLLADTIGQSLYERLLQARLDCPVTHWAPVHHPLAPQPSSTINCNLSINSSSTITSS
PSTSTSDFKSIPSSRTSHDSFHKPSSSPIHPPLPSNRIISLAGPITTSLPILTTITHLAAKHSQVSHMSLLDPSY
TIFLNTTHTAALCFKVVHQTAIIAGDPISSEENIPSLLSEFKTYRKAHLLGMAFLGASPRLTHYAETQTLTGSKS
TNNWTMLHFGTSRVLNPTTNALLNESTGKRLLLQNKQLLNPNKGGITLDIYIPGSNTTLENELQDIYTTWRTTRN
TSTTPQAFITEYTSPFSSTLLPSLMTYIYAKDKDGVPLAFAALRYCGANNGYHIDPCVALPTAPKGLTDLLMFAA
MALCRHAGVSYLSVGFEPLEELGEVRGLRGPLEHLARGAYRFAFKRLPSIQGKKAYHDKWRTEEGLEERLFLVLT
GAGGGLGVVAVTHVANVKIRRVVWG*
Coding >Ani_SJS72_1|g549.t1
ATGACTTCATCCAGCCCCCGCAAGCAAAAGAAATCCCAGCAGTCCAGCACCAAGGTGCTGCTGGCCGACACCATC
GGACAATCGCTGTACGAGCGTCTCCTGCAAGCCCGACTCGACTGTCCCGTCACCCACTGGGCACCTGTGCACCAT
CCTCTCGCTCCTCAGCCCTCGTCTACCATCAACTGTAACCTCAGCATCAACAGCAGCAGCACCATCACCTCGTCC
CCATCAACCTCCACCTCCGACTTCAAAAGCATCCCCTCCAGCCGCACCAGCCATGACTCTTTCCACAAACCCTCA
TCCTCACCCATCCACCCACCCCTCCCCTCCAACCGCATCATATCCCTCGCCGGACCCATCACCACCTCCCTCCCC
ATCCTCACCACCATCACCCACCTAGCCGCCAAGCACAGCCAAGTCTCACACATGTCCCTCCTCGACCCGAGCTAC
ACCATCTTCCTAAACACCACGCACACCGCGGCGCTCTGCTTCAAAGTCGTGCACCAAACGGCCATCATAGCCGGC
GACCCCATCAGCTCCGAAGAGAACATCCCATCTCTCCTCTCCGAATTCAAAACCTACCGCAAAGCCCACCTCCTC
GGCATGGCCTTCCTAGGCGCCAGCCCGCGTCTTACACACTACGCCGAAACCCAGACTTTAACCGGCAGCAAATCC
ACCAACAACTGGACAATGCTCCACTTCGGGACCTCACGCGTCCTCAACCCCACCACCAACGCCCTCCTCAACGAA
TCAACCGGAAAGCGTCTCCTCTTGCAGAATAAACAACTCCTAAATCCAAACAAAGGCGGCATAACCCTAGACATA
TACATCCCTGGCAGCAATACCACATTGGAAAATGAATTACAGGATATCTACACAACCTGGCGCACCACCCGCAAC
ACATCCACCACCCCCCAAGCCTTCATCACCGAATACACCTCCCCGTTCTCGTCGACCCTCCTTCCATCCCTGATG
ACATATATCTATGCCAAGGATAAAGACGGCGTGCCGCTCGCCTTCGCAGCCCTGCGCTACTGCGGCGCTAACAAC
GGATACCATATTGATCCGTGCGTTGCGCTGCCGACAGCTCCCAAGGGACTGACAGACCTGTTGATGTTTGCTGCG
ATGGCGCTGTGTCGGCATGCCGGGGTGTCGTATCTGAGTGTTGGGTTTGAGCCGTTAGAGGAGCTGGGTGAGGTG
AGGGGGTTGAGGGGCCCGTTGGAGCATCTGGCGAGAGGGGCATATCGCTTTGCGTTCAAGCGCTTGCCGTCCATA
CAGGGAAAGAAGGCGTATCATGATAAGTGGAGGACGGAGGAGGGGTTGGAGGAGAGGTTGTTTTTGGTCTTGACC
GGGGCCGGAGGCGGGTTGGGGGTCGTGGCTGTTACGCATGTTGCGAATGTGAAGATTAGGAGGGTGGTTTGGGGG
TGA
Transcript >Ani_SJS72_1|g549.t1
ATGACTTCATCCAGCCCCCGCAAGCAAAAGAAATCCCAGCAGTCCAGCACCAAGGTGCTGCTGGCCGACACCATC
GGACAATCGCTGTACGAGCGTCTCCTGCAAGCCCGACTCGACTGTCCCGTCACCCACTGGGCACCTGTGCACCAT
CCTCTCGCTCCTCAGCCCTCGTCTACCATCAACTGTAACCTCAGCATCAACAGCAGCAGCACCATCACCTCGTCC
CCATCAACCTCCACCTCCGACTTCAAAAGCATCCCCTCCAGCCGCACCAGCCATGACTCTTTCCACAAACCCTCA
TCCTCACCCATCCACCCACCCCTCCCCTCCAACCGCATCATATCCCTCGCCGGACCCATCACCACCTCCCTCCCC
ATCCTCACCACCATCACCCACCTAGCCGCCAAGCACAGCCAAGTCTCACACATGTCCCTCCTCGACCCGAGCTAC
ACCATCTTCCTAAACACCACGCACACCGCGGCGCTCTGCTTCAAAGTCGTGCACCAAACGGCCATCATAGCCGGC
GACCCCATCAGCTCCGAAGAGAACATCCCATCTCTCCTCTCCGAATTCAAAACCTACCGCAAAGCCCACCTCCTC
GGCATGGCCTTCCTAGGCGCCAGCCCGCGTCTTACACACTACGCCGAAACCCAGACTTTAACCGGCAGCAAATCC
ACCAACAACTGGACAATGCTCCACTTCGGGACCTCACGCGTCCTCAACCCCACCACCAACGCCCTCCTCAACGAA
TCAACCGGAAAGCGTCTCCTCTTGCAGAATAAACAACTCCTAAATCCAAACAAAGGCGGCATAACCCTAGACATA
TACATCCCTGGCAGCAATACCACATTGGAAAATGAATTACAGGATATCTACACAACCTGGCGCACCACCCGCAAC
ACATCCACCACCCCCCAAGCCTTCATCACCGAATACACCTCCCCGTTCTCGTCGACCCTCCTTCCATCCCTGATG
ACATATATCTATGCCAAGGATAAAGACGGCGTGCCGCTCGCCTTCGCAGCCCTGCGCTACTGCGGCGCTAACAAC
GGATACCATATTGATCCGTGCGTTGCGCTGCCGACAGCTCCCAAGGGACTGACAGACCTGTTGATGTTTGCTGCG
ATGGCGCTGTGTCGGCATGCCGGGGTGTCGTATCTGAGTGTTGGGTTTGAGCCGTTAGAGGAGCTGGGTGAGGTG
AGGGGGTTGAGGGGCCCGTTGGAGCATCTGGCGAGAGGGGCATATCGCTTTGCGTTCAAGCGCTTGCCGTCCATA
CAGGGAAAGAAGGCGTATCATGATAAGTGGAGGACGGAGGAGGGGTTGGAGGAGAGGTTGTTTTTGGTCTTGACC
GGGGCCGGAGGCGGGTTGGGGGTCGTGGCTGTTACGCATGTTGCGAATGTGAAGATTAGGAGGGTGGTTTGGGGG
TGA
Gene >Ani_SJS72_1|g549.t1
ATGACTTCATCCAGCCCCCGCAAGCAAAAGAAATCCCAGCAGTCCAGCACCAAGGTGCTGCTGGCCGACACCATC
GGACAATCGCTGTACGAGCGTCTCCTGCAAGCCCGACTCGACTGTCCCGTCACCCACTGGGCACCTGTGCACCAT
CCTCTCGCTCCTCAGCCCTCGTCTACCATCAACTGTAACCTCAGCATCAACAGCAGCAGCACCATCACCTCGTCC
CCATCAACCTCCACCTCCGACTTCAAAAGCATCCCCTCCAGCCGCACCAGCCATGACTCTTTCCACAAACCCTCA
TCCTCACCCATCCACCCACCCCTCCCCTCCAACCGCATCATATCCCTCGCCGGACCCATCACCACCTCCCTCCCC
ATCCTCACCACCATCACCCACCTAGCCGCCAAGCACAGCCAAGTCTCACACATGTCCCTCCTCGACCCGAGCTAC
ACCATCTTCCTAAACACCACGCACACCGCGGCGCTCTGCTTCAAAGTCGTGCACCAAACGGCCATCATAGCCGGC
GACCCCATCAGCTCCGAAGAGAACATCCCATCTCTCCTCTCCGAATTCAAAACCTACCGCAAAGCCCACCTCCTC
GGCATGGCCTTCCTAGGCGCCAGCCCGCGTCTTACACACTACGCCGAAACCCAGACTTTAACCGGCAGCAAATCC
ACCAACAACTGGACAATGCTCCACTTCGGGACCTCACGCGTCCTCAACCCCACCACCAACGCCCTCCTCAACGAA
TCAACCGGAAAGCGTCTCCTCTTGCAGAATAAACAACTCCTAAATCCAAACAAAGGCGGCATAACCCTAGACATA
TACATCCCTGGCAGCAATACCACATTGGAAAATGAATTACAGGATATCTACACAACCTGGCGCACCACCCGCAAC
ACATCCACCACCCCCCAAGCCTTCATCACCGAATACACCTCCCCGTTCTCGTCGACCCTCCTTCCATCCCTGATG
ACATATATCTATGCCAAGGATAAAGACGGCGTGCCGCTCGCCTTCGCAGCCCTGCGCTACTGCGGCGCTAACAAC
GGATACCATATTGATCCGTGCGTTGCGCTGCCGACAGCTCCCAAGGGACTGACAGACCTGTTGATGTTTGCTGCG
ATGGCGCTGTGTCGGCATGCCGGGGTGTCGTATCTGAGTGTTGGGTTTGAGCCGTTAGAGGAGCTGGGTGAGGTG
AGGGGGTTGAGGGGCCCGTTGGAGCATCTGGCGAGAGGGGCATATCGCTTTGCGTTCAAGCGCTTGCCGTCCATA
CAGGGAAAGAAGGCGTATCATGATAAGTGGAGGACGGAGGAGGGGTTGGAGGAGAGGTTGTTTTTGGTCTTGACC
GGGGCCGGAGGCGGGTTGGGGGTCGTGGCTGTTACGCATGTTGCGAATGTGAAGATTAGGAGGGTGGTTTGGGGG
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail