Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g5316.t1
Gene name
Locationscaffold_036:105942..107380
Strand+
Gene length (bp)1438
Transcript length (bp)1383
Coding sequence length (bp)1383
Protein length (aa) 461

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.1E-28 37 400
PF07690 MFS_1 Major Facilitator Superfamily 9.1E-10 251 429

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 26 48 22
2 72 94 22
3 101 122 21
4 132 154 22
5 159 181 22
6 191 213 22
7 315 337 22
8 352 374 22
9 387 409 22
10 419 441 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g5316.t1
MNAPASAEQHPPTEAPKNKHSRRQYVLIVLSGFMLNFTGCGVVFAYGVYQAEYEKMATQKDTAFTGSSSAEITLI
GSLSSAMMKLGAPFVVAWCKCFGPRIIVCVGGLIFGLANILASFGTASWHFQLSQGLLLGIGSCLSYMPSMIVPP
TWFSKRRGLALGIISAGTGIGGLVFAPVIQACIDTMGFRDTLRLVGCLSALLICASGAVLVWEPAMEQRLQEEVA
AKPSLVSRLFQFPLPPWSLVRQRKFIAQVLNAAFQSAAYYTPIYYISSYGQTLGYSESEGANWTSLSNACNAIGK
VAIGYLADYIGRLNSFFLVTLLSAVGAVALWIPSTLLGSTLHDLVAAKGCFIVFTIFYGLFASAYIGLFSPALVE
LFGLQEMPRITGIMYMVQGAAGLVGTPVSGVMVRTYNGETTSRSYLDMAIFVSALIVASTMTVAWARMEQGFDRV
SGHLTWKWKL*
Coding >Ani_SJS72_1|g5316.t1
ATGAACGCACCAGCCAGTGCCGAACAGCATCCGCCCACAGAGGCTCCCAAGAACAAGCACTCGCGGAGGCAATAT
GTCCTCATTGTCCTCTCCGGATTCATGCTCAACTTCACCGGCTGTGGAGTTGTCTTCGCCTACGGAGTTTACCAA
GCTGAGTACGAGAAGATGGCCACCCAAAAGGACACTGCATTCACCGGATCCTCATCCGCCGAGATTACATTGATT
GGGAGCTTGTCATCAGCCATGATGAAGCTTGGCGCCCCCTTCGTGGTGGCATGGTGCAAGTGTTTTGGTCCTCGC
ATTATTGTATGCGTAGGAGGACTTATATTCGGGTTAGCAAATATTCTCGCCAGCTTTGGAACAGCATCCTGGCAT
TTTCAACTCTCTCAAGGCCTTCTTCTGGGGATCGGCAGCTGTCTTTCCTACATGCCCTCGATGATCGTACCGCCC
ACATGGTTCTCAAAGCGCCGCGGACTCGCCCTTGGCATTATCTCTGCGGGAACCGGTATTGGCGGTCTGGTCTTC
GCCCCTGTCATCCAGGCCTGTATCGATACTATGGGTTTCCGTGATACACTCCGCTTGGTGGGTTGCTTGTCAGCA
CTGCTCATTTGTGCTTCGGGTGCTGTGCTGGTATGGGAGCCCGCTATGGAGCAACGCTTGCAGGAGGAAGTAGCA
GCCAAGCCCTCCTTAGTGTCTCGACTATTCCAGTTCCCACTGCCTCCTTGGTCTCTGGTCCGCCAGCGCAAATTC
ATCGCACAGGTGCTCAACGCAGCCTTTCAGAGCGCAGCCTACTACACGCCCATCTACTACATCTCGTCGTACGGA
CAGACGTTGGGCTACAGCGAGTCCGAGGGAGCCAACTGGACCTCTCTCAGCAATGCGTGCAATGCCATCGGTAAG
GTCGCCATCGGGTACCTGGCTGACTATATTGGGCGATTGAATTCCTTCTTCCTGGTCACTCTTCTCAGTGCTGTG
GGTGCGGTGGCACTCTGGATCCCCAGTACCTTGCTTGGGTCCACGTTGCATGACCTGGTGGCGGCCAAGGGCTGC
TTCATTGTTTTCACCATTTTCTACGGTCTCTTCGCTAGTGCCTATATTGGGCTGTTCTCGCCGGCTCTCGTGGAA
CTCTTTGGTTTGCAGGAGATGCCCCGTATCACGGGTATCATGTACATGGTGCAGGGAGCGGCTGGGTTGGTGGGC
ACCCCGGTGTCTGGAGTCATGGTACGCACGTACAATGGCGAGACTACCTCGCGTAGCTATTTGGATATGGCTATC
TTTGTCAGTGCGTTGATAGTGGCATCTACCATGACGGTTGCCTGGGCACGAATGGAACAGGGATTCGACCGTGTT
AGTGGCCATCTTACCTGGAAGTGGAAGCTCTAG
Transcript >Ani_SJS72_1|g5316.t1
ATGAACGCACCAGCCAGTGCCGAACAGCATCCGCCCACAGAGGCTCCCAAGAACAAGCACTCGCGGAGGCAATAT
GTCCTCATTGTCCTCTCCGGATTCATGCTCAACTTCACCGGCTGTGGAGTTGTCTTCGCCTACGGAGTTTACCAA
GCTGAGTACGAGAAGATGGCCACCCAAAAGGACACTGCATTCACCGGATCCTCATCCGCCGAGATTACATTGATT
GGGAGCTTGTCATCAGCCATGATGAAGCTTGGCGCCCCCTTCGTGGTGGCATGGTGCAAGTGTTTTGGTCCTCGC
ATTATTGTATGCGTAGGAGGACTTATATTCGGGTTAGCAAATATTCTCGCCAGCTTTGGAACAGCATCCTGGCAT
TTTCAACTCTCTCAAGGCCTTCTTCTGGGGATCGGCAGCTGTCTTTCCTACATGCCCTCGATGATCGTACCGCCC
ACATGGTTCTCAAAGCGCCGCGGACTCGCCCTTGGCATTATCTCTGCGGGAACCGGTATTGGCGGTCTGGTCTTC
GCCCCTGTCATCCAGGCCTGTATCGATACTATGGGTTTCCGTGATACACTCCGCTTGGTGGGTTGCTTGTCAGCA
CTGCTCATTTGTGCTTCGGGTGCTGTGCTGGTATGGGAGCCCGCTATGGAGCAACGCTTGCAGGAGGAAGTAGCA
GCCAAGCCCTCCTTAGTGTCTCGACTATTCCAGTTCCCACTGCCTCCTTGGTCTCTGGTCCGCCAGCGCAAATTC
ATCGCACAGGTGCTCAACGCAGCCTTTCAGAGCGCAGCCTACTACACGCCCATCTACTACATCTCGTCGTACGGA
CAGACGTTGGGCTACAGCGAGTCCGAGGGAGCCAACTGGACCTCTCTCAGCAATGCGTGCAATGCCATCGGTAAG
GTCGCCATCGGGTACCTGGCTGACTATATTGGGCGATTGAATTCCTTCTTCCTGGTCACTCTTCTCAGTGCTGTG
GGTGCGGTGGCACTCTGGATCCCCAGTACCTTGCTTGGGTCCACGTTGCATGACCTGGTGGCGGCCAAGGGCTGC
TTCATTGTTTTCACCATTTTCTACGGTCTCTTCGCTAGTGCCTATATTGGGCTGTTCTCGCCGGCTCTCGTGGAA
CTCTTTGGTTTGCAGGAGATGCCCCGTATCACGGGTATCATGTACATGGTGCAGGGAGCGGCTGGGTTGGTGGGC
ACCCCGGTGTCTGGAGTCATGGTACGCACGTACAATGGCGAGACTACCTCGCGTAGCTATTTGGATATGGCTATC
TTTGTCAGTGCGTTGATAGTGGCATCTACCATGACGGTTGCCTGGGCACGAATGGAACAGGGATTCGACCGTGTT
AGTGGCCATCTTACCTGGAAGTGGAAGCTCTAG
Gene >Ani_SJS72_1|g5316.t1
ATGAACGCACCAGCCAGTGCCGAACAGCATCCGCCCACAGAGGCTCCCAAGAACAAGCACTCGCGGAGGTACGGC
AACCTTACAACTGCTAGTATTGCCCTCGGCTCCTTCTGACCTGCTTAGGCAATATGTCCTCATTGTCCTCTCCGG
ATTCATGCTCAACTTCACCGGCTGTGGAGTTGTCTTCGCCTACGGAGTTTACCAAGCTGAGTACGAGAAGATGGC
CACCCAAAAGGACACTGCATTCACCGGATCCTCATCCGCCGAGATTACATTGATTGGGAGCTTGTCATCAGCCAT
GATGAAGCTTGGCGCCCCCTTCGTGGTGGCATGGTGCAAGTGTTTTGGTCCTCGCATTATTGTATGCGTAGGAGG
ACTTATATTCGGGTTAGCAAATATTCTCGCCAGCTTTGGAACAGCATCCTGGCATTTTCAACTCTCTCAAGGCCT
TCTTCTGGGGATCGGCAGCTGTCTTTCCTACATGCCCTCGATGATCGTACCGCCCACATGGTTCTCAAAGCGCCG
CGGACTCGCCCTTGGCATTATCTCTGCGGGAACCGGTATTGGCGGTCTGGTCTTCGCCCCTGTCATCCAGGCCTG
TATCGATACTATGGGTTTCCGTGATACACTCCGCTTGGTGGGTTGCTTGTCAGCACTGCTCATTTGTGCTTCGGG
TGCTGTGCTGGTATGGGAGCCCGCTATGGAGCAACGCTTGCAGGAGGAAGTAGCAGCCAAGCCCTCCTTAGTGTC
TCGACTATTCCAGTTCCCACTGCCTCCTTGGTCTCTGGTCCGCCAGCGCAAATTCATCGCACAGGTGCTCAACGC
AGCCTTTCAGAGCGCAGCCTACTACACGCCCATCTACTACATCTCGTCGTACGGACAGACGTTGGGCTACAGCGA
GTCCGAGGGAGCCAACTGGACCTCTCTCAGCAATGCGTGCAATGCCATCGGTAAGGTCGCCATCGGGTACCTGGC
TGACTATATTGGGCGATTGAATTCCTTCTTCCTGGTCACTCTTCTCAGTGCTGTGGGTGCGGTGGCACTCTGGAT
CCCCAGTACCTTGCTTGGGTCCACGTTGCATGACCTGGTGGCGGCCAAGGGCTGCTTCATTGTTTTCACCATTTT
CTACGGTCTCTTCGCTAGTGCCTATATTGGGCTGTTCTCGCCGGCTCTCGTGGAACTCTTTGGTTTGCAGGAGAT
GCCCCGTATCACGGGTATCATGTACATGGTGCAGGGAGCGGCTGGGTTGGTGGGCACCCCGGTGTCTGGAGTCAT
GGTACGCACGTACAATGGCGAGACTACCTCGCGTAGCTATTTGGATATGGCTATCTTTGTCAGTGCGTTGATAGT
GGCATCTACCATGACGGTTGCCTGGGCACGAATGGAACAGGGATTCGACCGTGTTAGTGGCCATCTTACCTGGAA
GTGGAAGCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail