Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g5257.t1
Gene name
Locationscaffold_035:216505..219040
Strand+
Gene length (bp)2535
Transcript length (bp)2343
Coding sequence length (bp)2343
Protein length (aa) 781

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02705 K_trans K+ potassium transporter 1.2E-180 72 648

GO

GO Term Description Terminal node
GO:0071805 potassium ion transmembrane transport Yes
GO:0015079 potassium ion transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0046873 metal ion transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0098662 inorganic cation transmembrane transport No
GO:0003674 molecular_function No
GO:0098655 cation transmembrane transport No
GO:0006812 cation transport No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0006813 potassium ion transport No
GO:0034220 ion transmembrane transport No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0098660 inorganic ion transmembrane transport No
GO:0030001 metal ion transport No
GO:0005575 cellular_component No
GO:0055085 transmembrane transport No
GO:0006811 ion transport No
GO:0009987 cellular process No
GO:0008324 cation transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

Domain # Start End Length
1 67 89 22
2 104 126 22
3 195 217 22
4 232 251 19
5 258 280 22
6 309 331 22
7 338 360 22
8 383 405 22
9 426 448 22
10 458 480 22
11 487 509 22
12 513 532 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g5257.t1
MKELPRQTTVEEKSQQTQESIYNIRPWNNNHLDRAISTVSTIGEDDDPGLRRPTDFKQKQDFSGKMLLWLAYQSI
GVIYGDIGTSPLYVYSSTFTEPPSRQDLIGVLSIIIWSITIMVTVKYIFIILHADNDGEGGTFSTYSLLSRYMNI
THRDPREASLVQMKRHLSIDLERSSRLARHRLETSKFAKRLLKVVGVLAVTMVLADGLLTPAQSVLGAVQGIEVV
SPNISKGTVIGVTDAILVILFLLQPLGITRVTFAFAPIVIIWLGFNAAFGIYNLAKYDAGVFVAFNPGYAFEFLI
RHGESGWRMLSGTLLAFTGVEALFADLGAFSRRAIQISWLCYTFPCLLLAYIGQAAYISVHPEAYSNPFYNAAPP
GTIYPALVIAILAAIVASQAIITATFQLLAQVMKLSYLPQFKVVHTSDIFHGQLYIPLANWLLMIGTILVASIYN
NTTSLGNAYGVCVIFVTFFDTCMVAMVAMFVWRKSPYLVFLPWLIIACFDGAYLSSALTKVPTGAWFTLAVATVL
ALLFLLWRFGKEQQWFAEAEDRFPTSHFVTKDQDGSIRLTDRFDGAPLSTTQGVGIFFDKAGETTPIVFSQFILK
LTTVFETIIFFHLRPLETPSVPIDDRYTVSKLAIPNCYRLVVRYGYNDEIISPDLASTITDQVRKYLIENKFTTT
PTEARTSISQFSRDIGQDTTSAEESRTITSRGKQIDPVALLEKACAHNVLYITGKEQMRVKRGTNIFRRFVLEIF
LWIRDNTRAKIASLGLGAEKVIEVGFLKDI*
Coding >Ani_SJS72_1|g5257.t1
ATGAAGGAGCTGCCAAGACAGACGACGGTGGAAGAAAAGTCCCAGCAGACACAAGAATCTATCTACAATATCCGC
CCATGGAATAACAATCACTTGGATCGCGCCATTAGTACAGTGAGTACTATCGGCGAGGATGATGACCCAGGCTTG
CGCAGACCTACAGACTTCAAGCAAAAGCAGGATTTCTCCGGGAAAATGCTTCTTTGGCTCGCATACCAGTCGATC
GGTGTCATCTACGGAGATATTGGAACCAGCCCGCTTTATGTCTATTCGTCTACATTCACTGAACCGCCTTCACGC
CAAGATCTTATCGGAGTACTTTCCATTATTATTTGGAGTATTACTATTATGGTGACCGTGAAATACATCTTCATA
ATCCTTCACGCGGATAATGATGGAGAGGGTGGTACATTCAGTACATATTCTCTGCTCAGTCGTTATATGAATATA
ACTCATCGAGATCCTCGAGAGGCATCCCTTGTGCAGATGAAGAGACACTTGTCGATTGATCTCGAGCGCTCCAGC
AGACTTGCTCGACACAGGCTGGAAACAAGCAAGTTCGCGAAGCGCCTACTAAAAGTTGTAGGAGTACTGGCCGTT
ACAATGGTTCTTGCAGATGGCCTACTCACTCCCGCTCAATCTGTGCTAGGTGCCGTCCAGGGAATTGAAGTTGTT
TCTCCGAACATTTCCAAAGGTACTGTTATTGGCGTCACGGATGCTATCCTGGTCATCTTGTTCTTGCTACAGCCA
CTTGGTATCACGCGGGTTACGTTCGCCTTTGCCCCAATCGTCATCATTTGGCTTGGTTTCAATGCTGCATTCGGA
ATCTATAATCTTGCTAAATACGATGCCGGAGTTTTTGTCGCTTTCAACCCCGGCTACGCTTTCGAATTTCTGATT
CGACATGGAGAATCAGGATGGAGGATGCTCAGTGGTACTTTACTTGCCTTCACCGGAGTCGAAGCTCTATTTGCC
GACCTTGGTGCTTTTAGTCGTCGGGCTATCCAGATAAGTTGGCTATGCTACACATTTCCTTGCCTGCTTCTGGCG
TACATCGGGCAGGCTGCATACATCAGTGTGCATCCAGAGGCATACTCGAACCCATTCTATAACGCAGCTCCTCCA
GGCACCATATATCCTGCGCTTGTAATTGCTATTCTAGCAGCTATTGTTGCATCGCAAGCAATTATCACCGCCACA
TTCCAGCTCCTAGCACAAGTGATGAAGCTCTCATACCTTCCGCAATTTAAGGTGGTTCATACATCCGATATATTC
CATGGTCAGCTTTATATACCTCTTGCGAACTGGCTATTGATGATCGGGACAATACTTGTGGCATCCATCTATAAC
AACACTACATCTCTTGGGAATGCATACGGAGTGTGTGTCATCTTTGTGACCTTCTTTGACACTTGCATGGTTGCA
ATGGTAGCAATGTTCGTATGGCGCAAGAGTCCTTACCTTGTGTTCCTGCCCTGGCTCATAATTGCTTGCTTTGAC
GGAGCATACCTTTCATCGGCGCTAACAAAAGTCCCAACTGGTGCATGGTTCACTCTCGCCGTAGCGACTGTTCTT
GCCTTGCTCTTCCTCCTCTGGCGATTCGGAAAGGAGCAGCAATGGTTCGCTGAAGCAGAAGATCGCTTCCCCACT
TCGCACTTTGTGACCAAGGATCAGGACGGTAGCATTCGCCTTACAGATAGGTTCGACGGTGCACCTTTGAGCACC
ACTCAGGGCGTAGGGATATTCTTCGACAAAGCTGGAGAGACCACGCCCATTGTCTTTAGCCAATTTATCCTAAAA
CTCACCACAGTGTTTGAGACGATCATCTTCTTCCATCTGCGGCCGCTCGAAACTCCGTCAGTCCCTATCGATGAC
CGCTACACTGTTTCAAAACTTGCGATTCCGAATTGCTACCGTCTGGTTGTCCGCTACGGCTACAATGACGAGATC
ATCTCTCCGGATCTCGCTAGCACCATCACTGATCAAGTCCGCAAATACTTAATTGAAAACAAATTCACTACTACA
CCAACTGAAGCGAGGACAAGCATTAGCCAGTTCAGTCGGGACATAGGCCAAGATACGACGAGTGCTGAAGAGTCC
CGGACCATCACCAGCCGAGGGAAACAGATCGATCCAGTGGCACTGCTGGAGAAGGCCTGTGCACATAACGTACTC
TACATCACTGGCAAGGAGCAGATGAGAGTTAAAAGGGGTACAAACATCTTCCGACGATTTGTGCTGGAGATCTTC
CTATGGATTCGGGACAATACGCGGGCGAAAATAGCTTCGTTGGGACTGGGAGCTGAGAAGGTGATTGAGGTGGGG
TTCTTGAAGGATATATGA
Transcript >Ani_SJS72_1|g5257.t1
ATGAAGGAGCTGCCAAGACAGACGACGGTGGAAGAAAAGTCCCAGCAGACACAAGAATCTATCTACAATATCCGC
CCATGGAATAACAATCACTTGGATCGCGCCATTAGTACAGTGAGTACTATCGGCGAGGATGATGACCCAGGCTTG
CGCAGACCTACAGACTTCAAGCAAAAGCAGGATTTCTCCGGGAAAATGCTTCTTTGGCTCGCATACCAGTCGATC
GGTGTCATCTACGGAGATATTGGAACCAGCCCGCTTTATGTCTATTCGTCTACATTCACTGAACCGCCTTCACGC
CAAGATCTTATCGGAGTACTTTCCATTATTATTTGGAGTATTACTATTATGGTGACCGTGAAATACATCTTCATA
ATCCTTCACGCGGATAATGATGGAGAGGGTGGTACATTCAGTACATATTCTCTGCTCAGTCGTTATATGAATATA
ACTCATCGAGATCCTCGAGAGGCATCCCTTGTGCAGATGAAGAGACACTTGTCGATTGATCTCGAGCGCTCCAGC
AGACTTGCTCGACACAGGCTGGAAACAAGCAAGTTCGCGAAGCGCCTACTAAAAGTTGTAGGAGTACTGGCCGTT
ACAATGGTTCTTGCAGATGGCCTACTCACTCCCGCTCAATCTGTGCTAGGTGCCGTCCAGGGAATTGAAGTTGTT
TCTCCGAACATTTCCAAAGGTACTGTTATTGGCGTCACGGATGCTATCCTGGTCATCTTGTTCTTGCTACAGCCA
CTTGGTATCACGCGGGTTACGTTCGCCTTTGCCCCAATCGTCATCATTTGGCTTGGTTTCAATGCTGCATTCGGA
ATCTATAATCTTGCTAAATACGATGCCGGAGTTTTTGTCGCTTTCAACCCCGGCTACGCTTTCGAATTTCTGATT
CGACATGGAGAATCAGGATGGAGGATGCTCAGTGGTACTTTACTTGCCTTCACCGGAGTCGAAGCTCTATTTGCC
GACCTTGGTGCTTTTAGTCGTCGGGCTATCCAGATAAGTTGGCTATGCTACACATTTCCTTGCCTGCTTCTGGCG
TACATCGGGCAGGCTGCATACATCAGTGTGCATCCAGAGGCATACTCGAACCCATTCTATAACGCAGCTCCTCCA
GGCACCATATATCCTGCGCTTGTAATTGCTATTCTAGCAGCTATTGTTGCATCGCAAGCAATTATCACCGCCACA
TTCCAGCTCCTAGCACAAGTGATGAAGCTCTCATACCTTCCGCAATTTAAGGTGGTTCATACATCCGATATATTC
CATGGTCAGCTTTATATACCTCTTGCGAACTGGCTATTGATGATCGGGACAATACTTGTGGCATCCATCTATAAC
AACACTACATCTCTTGGGAATGCATACGGAGTGTGTGTCATCTTTGTGACCTTCTTTGACACTTGCATGGTTGCA
ATGGTAGCAATGTTCGTATGGCGCAAGAGTCCTTACCTTGTGTTCCTGCCCTGGCTCATAATTGCTTGCTTTGAC
GGAGCATACCTTTCATCGGCGCTAACAAAAGTCCCAACTGGTGCATGGTTCACTCTCGCCGTAGCGACTGTTCTT
GCCTTGCTCTTCCTCCTCTGGCGATTCGGAAAGGAGCAGCAATGGTTCGCTGAAGCAGAAGATCGCTTCCCCACT
TCGCACTTTGTGACCAAGGATCAGGACGGTAGCATTCGCCTTACAGATAGGTTCGACGGTGCACCTTTGAGCACC
ACTCAGGGCGTAGGGATATTCTTCGACAAAGCTGGAGAGACCACGCCCATTGTCTTTAGCCAATTTATCCTAAAA
CTCACCACAGTGTTTGAGACGATCATCTTCTTCCATCTGCGGCCGCTCGAAACTCCGTCAGTCCCTATCGATGAC
CGCTACACTGTTTCAAAACTTGCGATTCCGAATTGCTACCGTCTGGTTGTCCGCTACGGCTACAATGACGAGATC
ATCTCTCCGGATCTCGCTAGCACCATCACTGATCAAGTCCGCAAATACTTAATTGAAAACAAATTCACTACTACA
CCAACTGAAGCGAGGACAAGCATTAGCCAGTTCAGTCGGGACATAGGCCAAGATACGACGAGTGCTGAAGAGTCC
CGGACCATCACCAGCCGAGGGAAACAGATCGATCCAGTGGCACTGCTGGAGAAGGCCTGTGCACATAACGTACTC
TACATCACTGGCAAGGAGCAGATGAGAGTTAAAAGGGGTACAAACATCTTCCGACGATTTGTGCTGGAGATCTTC
CTATGGATTCGGGACAATACGCGGGCGAAAATAGCTTCGTTGGGACTGGGAGCTGAGAAGGTGATTGAGGTGGGG
TTCTTGAAGGATATATGA
Gene >Ani_SJS72_1|g5257.t1
ATGAAGGAGCTGCCAAGACAGACGACGGTGGAAGAAAAGTCCCAGCAGACACAAGAATCTATCTACAATATCCGC
CCATGGAATAACAATCACTTGGATCGCGCCATTAGTACAGTGAGTACTATCGGCGAGGATGATGACCCAGGCTTG
CGCAGACCTACAGACTTCAAGCAAAAGCAGGTACGGATTGACATATTTTCCAGCGTACATAAGCACGCAAGCTGA
TACTAGCAGGATTTCTCCGGGAAAATGCTTCTTTGGCTCGCATACCAGTCGATCGGTGTCATCTACGGAGATATT
GGAACCAGCCCGCTTTATGTCTATTCGTCTACATTCACTGAACCGCCTTCACGCCAAGATCTTATCGGAGTACTT
TCCATTATTATTTGGAGTATTACTATTATGGTGACCGTGAAATACATCTTCATAATCCTTCACGCGGATAATGAT
GGAGAGGGTGGTACATTCAGTACATATTCTCTGCTCAGTCGTTATGTAAGACGCACTTTTCTCTGTGCAGGATGA
AACTGACCAGCTTAGATGAATATAACTCATCGAGATCCTCGAGAGGCATCCCTTGTGCAGATGAAGAGACACTTG
TCGATTGATCTCGAGCGCTCCAGCAGACTTGCTCGACACAGGCTGGAAACAAGCAAGTTCGCGAAGCGCCTACTA
AAAGTTGTAGGAGTACTGGCCGTTACAATGGTTCTTGCAGATGGCCTACTCACTCCCGCTCAATCTGTGCTAGGT
GCCGTCCAGGGAATTGAAGTTGTTTCTCCGAACATTTCCAAAGGTACTGTTATTGGCGTCACGGATGCTATCCTG
GTCATCTTGTTCTTGCTACAGCCACTTGGTATCACGCGGGTTACGTTCGCCTTTGCCCCAATCGTCATCATTTGG
CTTGGTTTCAATGCTGCATTCGGAATCTATAATCTTGCTAAATACGATGCCGGAGTTTTTGTCGCTTTCAACCCC
GGCTACGCTTTCGAATTTCTGATTCGACATGGAGAATCAGGATGGAGGATGCTCAGTGGTACTTTACTTGCCTTC
ACCGGAGTCGAAGCTCTATTTGCCGACCTTGGTGCTTTTAGTCGTCGGGCTATCCAGATAAGTTGGCTATGCTAC
ACATTTCCTTGCCTGCTTCTGGCGTACATCGGGCAGGCTGCATACATCAGTGTGCATCCAGAGGCATACTCGAAC
CCATTCTATAACGCAGCTCCTCCAGGCACCATATATCCTGCGCTTGTAATTGCTATTCTAGCAGCTATTGTTGCA
TCGCAAGCAATTATCACCGCCACATTCCAGGTATATAGTCCACCTGTATGAAATGATCAGTCTAACCCTGTTTAG
CTCCTAGCACAAGTGATGAAGCTCTCATACCTTCCGCAATTTAAGGTGGTTCATACATCCGATATATTCCATGGT
CAGCTTTATATACCTCTTGCGAACTGGCTATTGATGATCGGGACAATACTTGTGGCATCCATCTATAACAACGTA
TGTCAAAATGGTTTGTGCCCCTGGAAGTTCGCTAATTAAGTGCAGACTACATCTCTTGGGAATGCATACGGAGTG
TGTGTCATCTTTGTGACCTTCTTTGACACTTGCATGGTTGCAATGGTAGCAATGTTCGTATGGCGCAAGAGTCCT
TACCTTGTGTTCCTGCCCTGGCTCATAATTGCTTGCTTTGACGGAGCATACCTTTCATCGGCGCTAACAAAAGTC
CCAACTGGTGCATGGTTCACTCTCGCCGTAGCGACTGTTCTTGCCTTGCTCTTCCTCCTCTGGCGATTCGGAAAG
GAGCAGCAATGGTTCGCTGAAGCAGAAGATCGCTTCCCCACTTCGCACTTTGTGACCAAGGATCAGGACGGTAGC
ATTCGCCTTACAGATAGGTTCGACGGTGCACCTTTGAGCACCACTCAGGGCGTAGGGATATTCTTCGACAAAGCT
GGAGAGACCACGCCCATTGTCTTTAGCCAATTTATCCTAAAACTCACCACAGTGTTTGAGACGATCATCTTCTTC
CATCTGCGGCCGCTCGAAACTCCGTCAGTCCCTATCGATGACCGCTACACTGTTTCAAAACTTGCGATTCCGAAT
TGCTACCGTCTGGTTGTCCGCTACGGCTACAATGACGAGATCATCTCTCCGGATCTCGCTAGCACCATCACTGAT
CAAGTCCGCAAATACTTAATTGAAAACAAATTCACTACTACACCAACTGAAGCGAGGACAAGCATTAGCCAGTTC
AGTCGGGACATAGGCCAAGATACGACGAGTGCTGAAGAGTCCCGGACCATCACCAGCCGAGGGAAACAGATCGAT
CCAGTGGCACTGCTGGAGAAGGCCTGTGCACATAACGTACTCTACATCACTGGCAAGGAGCAGATGAGAGTTAAA
AGGGGTACAAACATCTTCCGACGATTTGTGCTGGAGATCTTCCTATGGATTCGGGACAATACGCGGGCGAAAATA
GCTTCGTTGGGACTGGGAGCTGAGAAGGTGATTGAGGTGGGGTTCTTGAAGGATATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail