Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g4873.t1
Gene name
Locationscaffold_031:295355..297881
Strand-
Gene length (bp)2526
Transcript length (bp)2526
Coding sequence length (bp)2526
Protein length (aa) 842

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07488 Glyco_hydro_67M Glycosyl hydrolase family 67 middle domain 1.1E-146 147 468
PF07477 Glyco_hydro_67C Glycosyl hydrolase family 67 C-terminus 5.0E-91 470 692
PF03648 Glyco_hydro_67N Glycosyl hydrolase family 67 N-terminus 2.2E-32 26 141

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0046559 alpha-glucuronidase activity Yes
GO:0045493 xylan catabolic process Yes
GO:0044264 cellular polysaccharide metabolic process No
GO:0010383 cell wall polysaccharide metabolic process No
GO:0009056 catabolic process No
GO:0110165 cellular anatomical entity No
GO:0016052 carbohydrate catabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0044347 cell wall polysaccharide catabolic process No
GO:1901575 organic substance catabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0000272 polysaccharide catabolic process No
GO:0008152 metabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0008150 biological_process No
GO:0044248 cellular catabolic process No
GO:0045491 xylan metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0010410 hemicellulose metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0044262 cellular carbohydrate metabolic process No
GO:0003824 catalytic activity No
GO:0005976 polysaccharide metabolic process No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0044036 cell wall macromolecule metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0016998 cell wall macromolecule catabolic process No
GO:0044237 cellular metabolic process No
GO:0005575 cellular_component No
GO:0005975 carbohydrate metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g4873.t1
MRGLNLFQLILALLLSMVAAEDGYDGWLRYAPVSCDLRCRQALPSHVVLLNSTKGSPIETAGRELKAGFQSILST
NLTSRPFQCNSSTSILVATLDEYRQRCRDINVPELDPDGFWLQSEGDTVRILGKDARGALYGAYEYLAMVAQRNF
SRVAYATSPHAPIRWVNQWDNMDGSIERGYGGASIFFKDGTVVEDMAPVEQYARLLASIRINAIVVNNVNANATL
LLPENMKGLGRIADACRPYGVQIGISLNFASPEDLGGLNTYDPLDPGVIAWWQNITDSLYTYVPDMAGYLVKADS
EGQPGPDTYNRTLSQGANLFARALQPYGGVLMYRAFVYDDNLNESDWKADRAKAAVEYFKDLDGQFEENVVIQIK
YGPIDFQVREPTSPLFANLYHTNTAIELEVSQEYLGQQCHLVYLPPLWKTVLDFDLRVDHKPSMVRDIISGQRFN
RTLGGWAAVVNVGTNRTWLGSHLAMSNLYAYGRLAWSPTDESEQILEDWTRLTFGQNHHVINTISDMSMTSWPAY
ENYTGNLGIQTLTDILYTHYGPNPATQDNNGWGQWTRADHDSVGMDRTIRNGTGYTGQYPEEVARVYESLESTPD
DLVLWFHHVPWTHRLHSGVTVIQHFYNAHYAGAEAAHGFVRQWESLEGLIDRERYEAMRSRLVYQAGHSIVWRDA
INNFYYNMTGIPDVAGRVGHHPWRIEAESMRLDGYQTYTVSPFEAASNTTAIITTSNSTTGTARTSIKAPSGVYD
IGVNYYDLYGGQSKWTLSVGDKVVGQWLGDMEHNSLGHTPSIYLDGHSATRITFHGVGIRQGDQLKIVGEANGVE
PAPLDYIVLLPPGLVD*
Coding >Ani_SJS72_1|g4873.t1
ATGAGAGGTTTGAATCTCTTTCAATTAATACTGGCTCTTCTGCTGTCCATGGTAGCAGCCGAGGATGGGTACGAT
GGCTGGCTCCGATATGCTCCCGTGTCCTGCGATCTGCGTTGTCGACAGGCTTTACCGTCTCATGTTGTGTTGTTG
AACAGCACCAAAGGAAGCCCAATCGAGACCGCCGGACGAGAATTGAAAGCGGGATTCCAATCGATTCTTTCGACG
AACTTGACATCTCGTCCATTTCAATGCAATAGCTCCACATCAATTCTGGTGGCTACTCTGGATGAGTACCGCCAA
AGATGCCGGGACATTAATGTGCCTGAGCTCGATCCCGATGGCTTCTGGTTACAATCCGAAGGGGACACAGTTCGG
ATCTTAGGCAAGGATGCCAGAGGAGCCTTGTACGGAGCATACGAATATCTAGCTATGGTGGCACAGCGAAATTTT
TCTCGTGTCGCGTATGCCACGAGCCCACATGCGCCGATCCGTTGGGTGAATCAATGGGACAACATGGACGGAAGC
ATTGAACGAGGATACGGTGGTGCGTCGATATTCTTCAAAGATGGCACGGTGGTGGAAGACATGGCTCCTGTTGAG
CAATATGCTAGACTGCTTGCATCCATCCGGATAAATGCAATTGTCGTCAATAATGTCAATGCGAACGCGACATTA
CTGCTACCCGAGAATATGAAAGGCCTGGGTCGTATAGCAGATGCATGTCGACCATACGGCGTTCAAATTGGCATA
TCGCTGAACTTTGCTTCACCCGAAGACTTGGGTGGTTTGAATACTTATGATCCACTCGATCCAGGTGTCATTGCA
TGGTGGCAGAATATCACTGATAGTCTCTATACCTATGTACCAGACATGGCTGGGTACCTCGTCAAAGCCGACTCA
GAGGGCCAGCCAGGTCCAGATACATACAATCGCACACTCTCACAAGGGGCAAATCTGTTCGCTCGTGCCCTGCAA
CCGTATGGGGGTGTGCTTATGTACCGTGCTTTCGTCTATGATGACAACTTGAACGAATCAGACTGGAAGGCTGAT
CGTGCTAAGGCAGCAGTGGAGTATTTCAAGGACCTGGACGGTCAATTCGAGGAGAACGTCGTGATCCAAATAAAG
TACGGCCCGATCGACTTCCAAGTGCGCGAGCCTACCTCACCACTTTTTGCCAACCTCTACCACACCAACACAGCC
ATAGAGTTGGAGGTTAGTCAGGAGTACCTGGGGCAGCAATGCCATTTGGTGTACTTACCTCCGCTCTGGAAGACG
GTCCTGGATTTCGACTTACGCGTAGACCACAAGCCATCGATGGTCCGCGATATCATATCCGGTCAGCGCTTCAAC
AGAACGCTCGGAGGCTGGGCAGCTGTCGTTAATGTGGGCACCAACAGAACATGGCTGGGTAGCCACCTTGCTATG
TCCAATCTGTACGCTTACGGTCGTTTGGCGTGGAGTCCGACAGACGAATCTGAGCAGATCCTCGAAGACTGGACT
CGCCTCACATTTGGACAAAATCACCATGTCATTAACACTATCTCCGATATGTCAATGACCTCCTGGCCTGCCTAT
GAAAACTATACCGGCAACCTGGGCATACAGACACTGACAGACATCTTGTATACCCACTATGGTCCAAATCCAGCT
ACACAGGATAACAATGGCTGGGGTCAATGGACACGTGCTGATCATGATTCTGTCGGTATGGATCGCACAATACGG
AACGGCACCGGCTATACCGGTCAATACCCGGAGGAGGTTGCTCGCGTATACGAATCACTAGAAAGCACGCCAGAT
GACCTAGTATTGTGGTTTCACCATGTACCATGGACGCACCGTCTGCACTCCGGAGTGACTGTTATCCAGCATTTC
TACAACGCTCACTATGCGGGCGCAGAAGCTGCACACGGATTCGTCAGACAATGGGAGTCTTTGGAAGGGCTCATT
GACCGGGAGCGATACGAAGCCATGCGGTCGCGACTGGTCTACCAGGCGGGACACTCCATTGTCTGGCGAGATGCT
ATCAATAATTTCTACTACAACATGACCGGAATCCCAGATGTGGCTGGACGTGTGGGTCACCATCCGTGGCGCATT
GAAGCCGAGAGTATGAGATTAGATGGATACCAGACGTATACGGTCAGTCCGTTCGAGGCTGCTTCTAATACTACA
GCAATTATTACCACTTCTAATTCAACGACTGGGACGGCGAGGACTAGCATCAAGGCCCCATCAGGAGTATACGAC
ATTGGGGTGAACTACTACGATCTCTATGGTGGTCAATCGAAGTGGACACTATCTGTGGGTGATAAGGTAGTGGGC
CAATGGCTTGGGGATATGGAGCATAATTCCCTAGGCCATACACCATCTATATACTTAGATGGTCACTCTGCCACT
CGGATTACGTTCCATGGGGTTGGCATTCGGCAGGGTGATCAGCTGAAGATTGTTGGGGAGGCGAATGGGGTCGAG
CCCGCTCCCCTGGATTATATAGTGCTACTGCCCCCAGGCTTAGTTGACTGA
Transcript >Ani_SJS72_1|g4873.t1
ATGAGAGGTTTGAATCTCTTTCAATTAATACTGGCTCTTCTGCTGTCCATGGTAGCAGCCGAGGATGGGTACGAT
GGCTGGCTCCGATATGCTCCCGTGTCCTGCGATCTGCGTTGTCGACAGGCTTTACCGTCTCATGTTGTGTTGTTG
AACAGCACCAAAGGAAGCCCAATCGAGACCGCCGGACGAGAATTGAAAGCGGGATTCCAATCGATTCTTTCGACG
AACTTGACATCTCGTCCATTTCAATGCAATAGCTCCACATCAATTCTGGTGGCTACTCTGGATGAGTACCGCCAA
AGATGCCGGGACATTAATGTGCCTGAGCTCGATCCCGATGGCTTCTGGTTACAATCCGAAGGGGACACAGTTCGG
ATCTTAGGCAAGGATGCCAGAGGAGCCTTGTACGGAGCATACGAATATCTAGCTATGGTGGCACAGCGAAATTTT
TCTCGTGTCGCGTATGCCACGAGCCCACATGCGCCGATCCGTTGGGTGAATCAATGGGACAACATGGACGGAAGC
ATTGAACGAGGATACGGTGGTGCGTCGATATTCTTCAAAGATGGCACGGTGGTGGAAGACATGGCTCCTGTTGAG
CAATATGCTAGACTGCTTGCATCCATCCGGATAAATGCAATTGTCGTCAATAATGTCAATGCGAACGCGACATTA
CTGCTACCCGAGAATATGAAAGGCCTGGGTCGTATAGCAGATGCATGTCGACCATACGGCGTTCAAATTGGCATA
TCGCTGAACTTTGCTTCACCCGAAGACTTGGGTGGTTTGAATACTTATGATCCACTCGATCCAGGTGTCATTGCA
TGGTGGCAGAATATCACTGATAGTCTCTATACCTATGTACCAGACATGGCTGGGTACCTCGTCAAAGCCGACTCA
GAGGGCCAGCCAGGTCCAGATACATACAATCGCACACTCTCACAAGGGGCAAATCTGTTCGCTCGTGCCCTGCAA
CCGTATGGGGGTGTGCTTATGTACCGTGCTTTCGTCTATGATGACAACTTGAACGAATCAGACTGGAAGGCTGAT
CGTGCTAAGGCAGCAGTGGAGTATTTCAAGGACCTGGACGGTCAATTCGAGGAGAACGTCGTGATCCAAATAAAG
TACGGCCCGATCGACTTCCAAGTGCGCGAGCCTACCTCACCACTTTTTGCCAACCTCTACCACACCAACACAGCC
ATAGAGTTGGAGGTTAGTCAGGAGTACCTGGGGCAGCAATGCCATTTGGTGTACTTACCTCCGCTCTGGAAGACG
GTCCTGGATTTCGACTTACGCGTAGACCACAAGCCATCGATGGTCCGCGATATCATATCCGGTCAGCGCTTCAAC
AGAACGCTCGGAGGCTGGGCAGCTGTCGTTAATGTGGGCACCAACAGAACATGGCTGGGTAGCCACCTTGCTATG
TCCAATCTGTACGCTTACGGTCGTTTGGCGTGGAGTCCGACAGACGAATCTGAGCAGATCCTCGAAGACTGGACT
CGCCTCACATTTGGACAAAATCACCATGTCATTAACACTATCTCCGATATGTCAATGACCTCCTGGCCTGCCTAT
GAAAACTATACCGGCAACCTGGGCATACAGACACTGACAGACATCTTGTATACCCACTATGGTCCAAATCCAGCT
ACACAGGATAACAATGGCTGGGGTCAATGGACACGTGCTGATCATGATTCTGTCGGTATGGATCGCACAATACGG
AACGGCACCGGCTATACCGGTCAATACCCGGAGGAGGTTGCTCGCGTATACGAATCACTAGAAAGCACGCCAGAT
GACCTAGTATTGTGGTTTCACCATGTACCATGGACGCACCGTCTGCACTCCGGAGTGACTGTTATCCAGCATTTC
TACAACGCTCACTATGCGGGCGCAGAAGCTGCACACGGATTCGTCAGACAATGGGAGTCTTTGGAAGGGCTCATT
GACCGGGAGCGATACGAAGCCATGCGGTCGCGACTGGTCTACCAGGCGGGACACTCCATTGTCTGGCGAGATGCT
ATCAATAATTTCTACTACAACATGACCGGAATCCCAGATGTGGCTGGACGTGTGGGTCACCATCCGTGGCGCATT
GAAGCCGAGAGTATGAGATTAGATGGATACCAGACGTATACGGTCAGTCCGTTCGAGGCTGCTTCTAATACTACA
GCAATTATTACCACTTCTAATTCAACGACTGGGACGGCGAGGACTAGCATCAAGGCCCCATCAGGAGTATACGAC
ATTGGGGTGAACTACTACGATCTCTATGGTGGTCAATCGAAGTGGACACTATCTGTGGGTGATAAGGTAGTGGGC
CAATGGCTTGGGGATATGGAGCATAATTCCCTAGGCCATACACCATCTATATACTTAGATGGTCACTCTGCCACT
CGGATTACGTTCCATGGGGTTGGCATTCGGCAGGGTGATCAGCTGAAGATTGTTGGGGAGGCGAATGGGGTCGAG
CCCGCTCCCCTGGATTATATAGTGCTACTGCCCCCAGGCTTAGTTGACTGA
Gene >Ani_SJS72_1|g4873.t1
ATGAGAGGTTTGAATCTCTTTCAATTAATACTGGCTCTTCTGCTGTCCATGGTAGCAGCCGAGGATGGGTACGAT
GGCTGGCTCCGATATGCTCCCGTGTCCTGCGATCTGCGTTGTCGACAGGCTTTACCGTCTCATGTTGTGTTGTTG
AACAGCACCAAAGGAAGCCCAATCGAGACCGCCGGACGAGAATTGAAAGCGGGATTCCAATCGATTCTTTCGACG
AACTTGACATCTCGTCCATTTCAATGCAATAGCTCCACATCAATTCTGGTGGCTACTCTGGATGAGTACCGCCAA
AGATGCCGGGACATTAATGTGCCTGAGCTCGATCCCGATGGCTTCTGGTTACAATCCGAAGGGGACACAGTTCGG
ATCTTAGGCAAGGATGCCAGAGGAGCCTTGTACGGAGCATACGAATATCTAGCTATGGTGGCACAGCGAAATTTT
TCTCGTGTCGCGTATGCCACGAGCCCACATGCGCCGATCCGTTGGGTGAATCAATGGGACAACATGGACGGAAGC
ATTGAACGAGGATACGGTGGTGCGTCGATATTCTTCAAAGATGGCACGGTGGTGGAAGACATGGCTCCTGTTGAG
CAATATGCTAGACTGCTTGCATCCATCCGGATAAATGCAATTGTCGTCAATAATGTCAATGCGAACGCGACATTA
CTGCTACCCGAGAATATGAAAGGCCTGGGTCGTATAGCAGATGCATGTCGACCATACGGCGTTCAAATTGGCATA
TCGCTGAACTTTGCTTCACCCGAAGACTTGGGTGGTTTGAATACTTATGATCCACTCGATCCAGGTGTCATTGCA
TGGTGGCAGAATATCACTGATAGTCTCTATACCTATGTACCAGACATGGCTGGGTACCTCGTCAAAGCCGACTCA
GAGGGCCAGCCAGGTCCAGATACATACAATCGCACACTCTCACAAGGGGCAAATCTGTTCGCTCGTGCCCTGCAA
CCGTATGGGGGTGTGCTTATGTACCGTGCTTTCGTCTATGATGACAACTTGAACGAATCAGACTGGAAGGCTGAT
CGTGCTAAGGCAGCAGTGGAGTATTTCAAGGACCTGGACGGTCAATTCGAGGAGAACGTCGTGATCCAAATAAAG
TACGGCCCGATCGACTTCCAAGTGCGCGAGCCTACCTCACCACTTTTTGCCAACCTCTACCACACCAACACAGCC
ATAGAGTTGGAGGTTAGTCAGGAGTACCTGGGGCAGCAATGCCATTTGGTGTACTTACCTCCGCTCTGGAAGACG
GTCCTGGATTTCGACTTACGCGTAGACCACAAGCCATCGATGGTCCGCGATATCATATCCGGTCAGCGCTTCAAC
AGAACGCTCGGAGGCTGGGCAGCTGTCGTTAATGTGGGCACCAACAGAACATGGCTGGGTAGCCACCTTGCTATG
TCCAATCTGTACGCTTACGGTCGTTTGGCGTGGAGTCCGACAGACGAATCTGAGCAGATCCTCGAAGACTGGACT
CGCCTCACATTTGGACAAAATCACCATGTCATTAACACTATCTCCGATATGTCAATGACCTCCTGGCCTGCCTAT
GAAAACTATACCGGCAACCTGGGCATACAGACACTGACAGACATCTTGTATACCCACTATGGTCCAAATCCAGCT
ACACAGGATAACAATGGCTGGGGTCAATGGACACGTGCTGATCATGATTCTGTCGGTATGGATCGCACAATACGG
AACGGCACCGGCTATACCGGTCAATACCCGGAGGAGGTTGCTCGCGTATACGAATCACTAGAAAGCACGCCAGAT
GACCTAGTATTGTGGTTTCACCATGTACCATGGACGCACCGTCTGCACTCCGGAGTGACTGTTATCCAGCATTTC
TACAACGCTCACTATGCGGGCGCAGAAGCTGCACACGGATTCGTCAGACAATGGGAGTCTTTGGAAGGGCTCATT
GACCGGGAGCGATACGAAGCCATGCGGTCGCGACTGGTCTACCAGGCGGGACACTCCATTGTCTGGCGAGATGCT
ATCAATAATTTCTACTACAACATGACCGGAATCCCAGATGTGGCTGGACGTGTGGGTCACCATCCGTGGCGCATT
GAAGCCGAGAGTATGAGATTAGATGGATACCAGACGTATACGGTCAGTCCGTTCGAGGCTGCTTCTAATACTACA
GCAATTATTACCACTTCTAATTCAACGACTGGGACGGCGAGGACTAGCATCAAGGCCCCATCAGGAGTATACGAC
ATTGGGGTGAACTACTACGATCTCTATGGTGGTCAATCGAAGTGGACACTATCTGTGGGTGATAAGGTAGTGGGC
CAATGGCTTGGGGATATGGAGCATAATTCCCTAGGCCATACACCATCTATATACTTAGATGGTCACTCTGCCACT
CGGATTACGTTCCATGGGGTTGGCATTCGGCAGGGTGATCAGCTGAAGATTGTTGGGGAGGCGAATGGGGTCGAG
CCCGCTCCCCTGGATTATATAGTGCTACTGCCCCCAGGCTTAGTTGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail