Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g4702.t1
Gene name
Locationscaffold_030:77195..78342
Strand-
Gene length (bp)1147
Transcript length (bp)1029
Coding sequence length (bp)1029
Protein length (aa) 343

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01151 ELO GNS1/SUR4 family 1.6E-63 48 289

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0009922 fatty acid elongase activity Yes
GO:0004312 fatty acid synthase activity No
GO:0110165 cellular anatomical entity No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0016746 acyltransferase activity No
GO:0003674 molecular_function No
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 46 68 22
2 89 111 22
3 131 153 22
4 158 180 22
5 185 202 17
6 222 244 22
7 259 281 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g4702.t1
MDVLQSLPLPSIDRPFGIHLWPIFDKAFELVVGYPASEFRFEEGVTPMSTFKETAIALVAYYVIIFGGREFMKNR
PAFKLNTLFMIHNLYLTLISGTLLALFIEQLLPTVWRHGIFYAICDHDGGWTRPLIVLYYLNYLTKYLELIDTVF
LFLKKKPLTFLHTYHHGATALLCYTQLIGLTAVQWVVIDINLLVHVVMYWYYFQSARGIRIWWKEWITRLQIIQF
VIDLGFIYFASYTYFSSTYFPWAPNMGKCAGEEFAAFSGMAVISSYLFLFISFYVATYKKAAKAGRPRRNTGKQA
VIDMAKFEVSSPNADAKGNAKSNGAAVSTGRANGPVTRSRKA*
Coding >Ani_SJS72_1|g4702.t1
ATGGATGTCCTGCAAAGTCTGCCTTTGCCGTCAATTGACCGGCCGTTTGGTATCCACCTATGGCCTATCTTCGAC
AAGGCCTTCGAGCTGGTGGTGGGCTATCCTGCCAGCGAGTTTCGCTTTGAAGAAGGCGTGACGCCCATGTCTACT
TTCAAGGAAACCGCCATTGCGCTCGTTGCCTACTATGTCATCATCTTTGGTGGCCGTGAGTTCATGAAGAACAGA
CCTGCCTTCAAGCTCAACACGCTTTTCATGATCCACAACCTTTACCTCACCCTGATCAGCGGCACTCTCTTGGCT
CTCTTCATTGAGCAGCTTCTCCCTACTGTCTGGAGACATGGTATCTTCTATGCTATCTGTGACCACGACGGTGGA
TGGACGCGGCCTCTTATCGTTCTGTACTATCTCAACTATTTGACCAAGTACCTCGAACTCATTGACACCGTCTTC
CTGTTCCTCAAGAAGAAGCCTCTTACCTTCCTTCATACCTACCACCACGGTGCCACCGCGCTTCTCTGCTATACC
CAGCTTATTGGCTTGACTGCGGTTCAGTGGGTTGTCATTGATATCAACCTCCTGGTGCACGTCGTCATGTACTGG
TACTACTTCCAGAGTGCCCGTGGTATCCGTATCTGGTGGAAGGAGTGGATCACCCGTCTCCAGATTATTCAGTTC
GTCATCGATCTCGGCTTCATCTACTTCGCTTCTTACACCTACTTCTCCTCTACTTACTTCCCCTGGGCTCCCAAC
ATGGGCAAGTGCGCCGGCGAGGAGTTTGCCGCTTTCTCCGGCATGGCTGTCATCAGCTCTTACCTCTTCCTCTTC
ATCTCCTTCTACGTCGCTACCTACAAGAAGGCTGCCAAGGCCGGCCGTCCCCGCCGCAACACTGGCAAGCAGGCT
GTTATTGACATGGCCAAGTTCGAGGTCTCTTCGCCGAACGCTGACGCCAAGGGCAACGCCAAGTCCAACGGAGCT
GCTGTGTCGACCGGCCGTGCCAATGGCCCGGTTACCCGCTCCCGCAAGGCTTAA
Transcript >Ani_SJS72_1|g4702.t1
ATGGATGTCCTGCAAAGTCTGCCTTTGCCGTCAATTGACCGGCCGTTTGGTATCCACCTATGGCCTATCTTCGAC
AAGGCCTTCGAGCTGGTGGTGGGCTATCCTGCCAGCGAGTTTCGCTTTGAAGAAGGCGTGACGCCCATGTCTACT
TTCAAGGAAACCGCCATTGCGCTCGTTGCCTACTATGTCATCATCTTTGGTGGCCGTGAGTTCATGAAGAACAGA
CCTGCCTTCAAGCTCAACACGCTTTTCATGATCCACAACCTTTACCTCACCCTGATCAGCGGCACTCTCTTGGCT
CTCTTCATTGAGCAGCTTCTCCCTACTGTCTGGAGACATGGTATCTTCTATGCTATCTGTGACCACGACGGTGGA
TGGACGCGGCCTCTTATCGTTCTGTACTATCTCAACTATTTGACCAAGTACCTCGAACTCATTGACACCGTCTTC
CTGTTCCTCAAGAAGAAGCCTCTTACCTTCCTTCATACCTACCACCACGGTGCCACCGCGCTTCTCTGCTATACC
CAGCTTATTGGCTTGACTGCGGTTCAGTGGGTTGTCATTGATATCAACCTCCTGGTGCACGTCGTCATGTACTGG
TACTACTTCCAGAGTGCCCGTGGTATCCGTATCTGGTGGAAGGAGTGGATCACCCGTCTCCAGATTATTCAGTTC
GTCATCGATCTCGGCTTCATCTACTTCGCTTCTTACACCTACTTCTCCTCTACTTACTTCCCCTGGGCTCCCAAC
ATGGGCAAGTGCGCCGGCGAGGAGTTTGCCGCTTTCTCCGGCATGGCTGTCATCAGCTCTTACCTCTTCCTCTTC
ATCTCCTTCTACGTCGCTACCTACAAGAAGGCTGCCAAGGCCGGCCGTCCCCGCCGCAACACTGGCAAGCAGGCT
GTTATTGACATGGCCAAGTTCGAGGTCTCTTCGCCGAACGCTGACGCCAAGGGCAACGCCAAGTCCAACGGAGCT
GCTGTGTCGACCGGCCGTGCCAATGGCCCGGTTACCCGCTCCCGCAAGGCTTAA
Gene >Ani_SJS72_1|g4702.t1
ATGGATGTCCTGCAAAGTCTGCCTTTGCCGTCAATTGACCGGCCGTTTGGTATCCACCTATGGCCTATCTTCGAC
AAGGCCTTCGAGCTGGTGGTGGGCTATCCTGCCAGCGAGTTTCGCTTTGAAGAAGGCGTGACGCCCATGTCTACT
TTCAAGGAAACCGCCATTGCGCTCGTTGCCTACTATGTCATCATCTTTGGTGGCCGTGAGTTCATGAAGAACAGA
CCTGCCTTCAAGCTCAACACGCTTTTCATGATCCACAACCTTTACCTCACCCTGATCAGCGGCACTCTCTTGGCT
CTCTTCATTGAGCAGCTTCTCCCTACTGTCTGGAGACATGGTATCTTCTATGCTATCTGTGACCACGACGGTGGA
TGGACGCGGCCTCTTATCGTTCTGTACTATGTGAGTACTCACGGCGCGGGACAAGTTTCGCTACGATCGGATCCG
GTATGCTAACGATATCGCGAATAGCTCAACTATTTGACCAAGTACCTCGAACTCATTGACACCGTCTTCCTGTTC
CTCAAGAAGAAGCCTCTTACCTTCCTTCATACCTACCACCACGGTGCCACCGCGCTTCTCTGCTATACCCAGCTT
ATTGGCTTGACTGCGGTTCAGTGGGTTGTCATTGATATCAACCTCCTGGTGCACGTCGTCATGTACTGGTACTAC
TTCCAGAGTGCCCGTGGTATCCGTATCTGGTGGAAGGAGTGGATCACCCGTCTCCAGATTATTCAGTTCGTCATC
GATCTCGGTTAGTAACCATTTCCAGCTCCGCATCGCTTCAACTAACCAGGTGACAGGCTTCATCTACTTCGCTTC
TTACACCTACTTCTCCTCTACTTACTTCCCCTGGGCTCCCAACATGGGCAAGTGCGCCGGCGAGGAGTTTGCCGC
TTTCTCCGGCATGGCTGTCATCAGCTCTTACCTCTTCCTCTTCATCTCCTTCTACGTCGCTACCTACAAGAAGGC
TGCCAAGGCCGGCCGTCCCCGCCGCAACACTGGCAAGCAGGCTGTTATTGACATGGCCAAGTTCGAGGTCTCTTC
GCCGAACGCTGACGCCAAGGGCAACGCCAAGTCCAACGGAGCTGCTGTGTCGACCGGCCGTGCCAATGGCCCGGT
TACCCGCTCCCGCAAGGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail