Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g4682.t1
Gene name
Locationscaffold_029:306080..307893
Strand+
Gene length (bp)1813
Transcript length (bp)1602
Coding sequence length (bp)1602
Protein length (aa) 534

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.5E-63 69 331
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 2.0E-35 69 328
PF03109 ABC1 ABC1 atypical kinase-like domain 3.5E-06 136 216
PF17667 Pkinase_fungal Fungal protein kinase 6.5E-06 172 248

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0030554 adenyl nucleotide binding No
GO:0003674 molecular_function No
GO:0019538 protein metabolic process No
GO:0043168 anion binding No
GO:0032553 ribonucleotide binding No
GO:0005488 binding No
GO:0006796 phosphate-containing compound metabolic process No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0043412 macromolecule modification No
GO:0006793 phosphorus metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0008152 metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0008150 biological_process No
GO:0016310 phosphorylation No
GO:0017076 purine nucleotide binding No
GO:0016301 kinase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043170 macromolecule metabolic process No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0044238 primary metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0036211 protein modification process No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g4682.t1
MADQFKARTLKRKNVKGLALNAAPKPASNNSDGDAQVPGAIGNTDSNRTDTLEIGLEFRLDLRSEDLVTLKELGA
GNGGTVSKVMHASTKVVMARKIIRVDAKENVRKQILRELQVGHDCNSPHIVTFYGAFQNEARDIVLCMEYMDCGS
LDRISKDFGPVRVDVLGKITESVLAGLVYLYEAHRIMHRDIKPSNILVNSRGNIKLCDFGVATETVNSIADTFVG
TSTYMAPERIQGGAYTVRSDVWSVGLTVMELAVGRFPFDTSDSSAGDRASAGPMGILDLLQQIVHEPAPKLPKSD
AFPPILHEFVAKCLLKKSEERPTPRELYDKDAFLQAAKRTPVDLQEWAISMMERHNRKSYLAPPPPKSLKDEPPA
ARSTPSPKPQPQQQPSSKPMRTPQYAPSDIPSSVGRNSPSQYQYNYAPANPSPRPPRSTRSPPISLEHLSLEDEY
RSGRRPSRTPVGGPSSGLEPPMNPMGSRSASSHNTKSRMPLQSAALPVRNAPPPSGPSPSAPGNGSWQRQPNSMR
GDHMTGAV*
Coding >Ani_SJS72_1|g4682.t1
ATGGCCGATCAATTCAAGGCGCGAACGCTGAAGCGCAAGAACGTCAAAGGCCTTGCCCTGAACGCAGCTCCGAAG
CCCGCCTCCAATAATTCCGATGGCGATGCTCAGGTTCCAGGCGCCATTGGGAACACCGACAGCAACCGCACCGAT
ACTCTGGAGATCGGCCTCGAGTTTCGTCTTGACCTGCGTAGCGAGGATCTGGTTACCCTGAAGGAGCTGGGCGCT
GGAAATGGTGGTACGGTCTCAAAGGTCATGCACGCCTCCACGAAGGTGGTCATGGCTCGAAAGATAATCCGCGTC
GACGCAAAGGAGAATGTGAGAAAGCAGATCTTGCGGGAACTCCAGGTTGGACACGACTGCAATTCCCCCCACATT
GTCACCTTCTATGGTGCCTTCCAGAATGAAGCCAGAGATATTGTCTTGTGTATGGAGTACATGGATTGCGGCTCG
CTCGATCGCATATCCAAGGACTTTGGTCCCGTGCGGGTAGACGTGTTGGGCAAAATCACTGAGTCGGTCCTGGCC
GGTCTGGTGTACCTGTACGAAGCTCATCGTATCATGCATCGCGATATCAAGCCATCCAACATCCTCGTCAACTCG
CGCGGCAACATCAAGCTCTGCGACTTTGGCGTTGCGACTGAGACAGTCAACTCGATCGCTGATACGTTCGTCGGC
ACCTCCACCTACATGGCCCCCGAGCGTATCCAGGGTGGTGCGTACACTGTGCGCTCGGATGTGTGGAGTGTCGGG
TTGACGGTGATGGAATTGGCGGTTGGTCGCTTCCCCTTTGACACGTCCGACTCCTCAGCAGGCGACCGTGCCAGC
GCCGGTCCGATGGGTATTCTGGATCTGCTGCAGCAGATTGTGCACGAGCCTGCTCCGAAGTTGCCCAAGAGCGAC
GCCTTCCCTCCCATCCTGCACGAGTTTGTCGCCAAATGTCTCCTCAAGAAGTCCGAGGAACGCCCCACGCCTCGC
GAGCTTTATGACAAGGATGCGTTCCTGCAGGCCGCCAAGCGGACGCCGGTTGATCTCCAAGAATGGGCCATCAGC
ATGATGGAGCGACACAACCGCAAGTCGTATCTGGCTCCCCCGCCGCCCAAGTCGCTCAAGGACGAGCCCCCAGCT
GCGCGATCGACTCCGTCCCCGAAGCCTCAACCCCAGCAGCAGCCCAGCAGCAAGCCGATGCGCACTCCCCAGTAC
GCCCCCAGCGACATTCCCTCCAGCGTGGGCCGCAACAGCCCCTCGCAGTACCAGTACAACTACGCCCCCGCCAAC
CCATCCCCGCGTCCACCCCGGTCAACACGCTCGCCTCCCATCTCTCTCGAGCATCTGTCGTTGGAAGATGAGTAC
CGCTCCGGCCGTCGTCCCTCACGGACTCCCGTCGGGGGCCCCTCTTCCGGATTGGAACCCCCCATGAACCCGATG
GGATCTCGTTCCGCCAGCTCACACAACACGAAGTCGCGAATGCCTCTACAGTCAGCAGCGCTGCCCGTGCGAAAC
GCGCCTCCCCCGAGCGGGCCTTCGCCCTCTGCTCCTGGAAATGGATCCTGGCAGCGCCAGCCAAACTCCATGCGC
GGGGACCATATGACGGGTGCCGTCTAG
Transcript >Ani_SJS72_1|g4682.t1
ATGGCCGATCAATTCAAGGCGCGAACGCTGAAGCGCAAGAACGTCAAAGGCCTTGCCCTGAACGCAGCTCCGAAG
CCCGCCTCCAATAATTCCGATGGCGATGCTCAGGTTCCAGGCGCCATTGGGAACACCGACAGCAACCGCACCGAT
ACTCTGGAGATCGGCCTCGAGTTTCGTCTTGACCTGCGTAGCGAGGATCTGGTTACCCTGAAGGAGCTGGGCGCT
GGAAATGGTGGTACGGTCTCAAAGGTCATGCACGCCTCCACGAAGGTGGTCATGGCTCGAAAGATAATCCGCGTC
GACGCAAAGGAGAATGTGAGAAAGCAGATCTTGCGGGAACTCCAGGTTGGACACGACTGCAATTCCCCCCACATT
GTCACCTTCTATGGTGCCTTCCAGAATGAAGCCAGAGATATTGTCTTGTGTATGGAGTACATGGATTGCGGCTCG
CTCGATCGCATATCCAAGGACTTTGGTCCCGTGCGGGTAGACGTGTTGGGCAAAATCACTGAGTCGGTCCTGGCC
GGTCTGGTGTACCTGTACGAAGCTCATCGTATCATGCATCGCGATATCAAGCCATCCAACATCCTCGTCAACTCG
CGCGGCAACATCAAGCTCTGCGACTTTGGCGTTGCGACTGAGACAGTCAACTCGATCGCTGATACGTTCGTCGGC
ACCTCCACCTACATGGCCCCCGAGCGTATCCAGGGTGGTGCGTACACTGTGCGCTCGGATGTGTGGAGTGTCGGG
TTGACGGTGATGGAATTGGCGGTTGGTCGCTTCCCCTTTGACACGTCCGACTCCTCAGCAGGCGACCGTGCCAGC
GCCGGTCCGATGGGTATTCTGGATCTGCTGCAGCAGATTGTGCACGAGCCTGCTCCGAAGTTGCCCAAGAGCGAC
GCCTTCCCTCCCATCCTGCACGAGTTTGTCGCCAAATGTCTCCTCAAGAAGTCCGAGGAACGCCCCACGCCTCGC
GAGCTTTATGACAAGGATGCGTTCCTGCAGGCCGCCAAGCGGACGCCGGTTGATCTCCAAGAATGGGCCATCAGC
ATGATGGAGCGACACAACCGCAAGTCGTATCTGGCTCCCCCGCCGCCCAAGTCGCTCAAGGACGAGCCCCCAGCT
GCGCGATCGACTCCGTCCCCGAAGCCTCAACCCCAGCAGCAGCCCAGCAGCAAGCCGATGCGCACTCCCCAGTAC
GCCCCCAGCGACATTCCCTCCAGCGTGGGCCGCAACAGCCCCTCGCAGTACCAGTACAACTACGCCCCCGCCAAC
CCATCCCCGCGTCCACCCCGGTCAACACGCTCGCCTCCCATCTCTCTCGAGCATCTGTCGTTGGAAGATGAGTAC
CGCTCCGGCCGTCGTCCCTCACGGACTCCCGTCGGGGGCCCCTCTTCCGGATTGGAACCCCCCATGAACCCGATG
GGATCTCGTTCCGCCAGCTCACACAACACGAAGTCGCGAATGCCTCTACAGTCAGCAGCGCTGCCCGTGCGAAAC
GCGCCTCCCCCGAGCGGGCCTTCGCCCTCTGCTCCTGGAAATGGATCCTGGCAGCGCCAGCCAAACTCCATGCGC
GGGGACCATATGACGGGTGCCGTCTAG
Gene >Ani_SJS72_1|g4682.t1
ATGGCCGATCAATTCAAGGCGCGAACGCTGAAGCGCAAGAACGTCAAAGGCCTTGCCCTGAACGCAGCTCCGAAG
CCCGCCTCCAATAATTCCGATGGCGATGCTCAGGTTCCAGGCGCCATTGGGAACACCGACAGCAACCGCACCGAT
ACTCTGGAGATCGGCCTCGAGTTTCGTCTTGACCTGCGTAGCGAGGATCTGGTTACCCTGAAGGAGCTGGGCGCT
GGAAATGGTGGTACGGTCTCAAAGGTCATGCACGCCTCCACGAAGGTGGTCATGGCTCGAAAGGTGCGTGCCTTC
TGGAGACCCTCGTCGTCCGTGCTTTGCCGTAGACCCGGCAGGTATGCTGACCCCGTCGTCCTAGATAATCCGCGT
CGACGCAAAGGAGAATGTGAGAAAGCAGATCTTGCGGGAACTCCAGGTTGGACACGACTGCAATTCCCCCCACAT
TGTCACCTTCTATGGTGCCTTCCAGAATGAAGCCAGAGATATTGTCTTGTGTATGGAGTACATGGATTGCGGGTA
AGGGAGCCGCTGCCTTTCCTTTTCTTCTGTTGGTTCCAAGCTAACCTGGACCCTCGCATGATAGCTCGCTCGATC
GCATATCCAAGGACTTTGGTCCCGTGCGGGTAGACGTGTTGGGCAAAATCACTGAGTCGGTCCTGGCCGGTCTGG
TGTACCTGTACGAAGCTCATCGTATCATGCATCGCGATATCAAGCCATCCAACATCCTCGTCAACTCGCGCGGCA
ACATCAAGCTCTGCGACTTTGGCGTTGCGACTGAGACAGTCAACTCGATCGCTGATACGTTCGTCGGCACCTCCA
CCTACATGGCCCCCGAGCGTATCCAGGGTGGTGCGTACACTGTGCGCTCGGATGTGTGGAGTGTCGGGTTGACGG
TGATGGAATTGGCGGTTGGTCGCTTCCCCTTTGACACGTCCGACTCCTCAGCAGGCGACCGTGCCAGCGCCGGTC
CGATGGGTATTCTGGATCTGCTGCAGCAGATTGTGCACGAGCCTGCTCCGAAGTTGCCCAAGAGCGACGCCTTCC
CTCCCATCCTGCACGAGTTTGTCGCCAAATGTCTCCTCAAGAAGTCCGAGGAACGCCCCACGCCTCGCGAGCTTT
ATGTATGTCTCACCCTTTGTCCGCTTTTGGACTACGGTCTTGAGCCGGATCCGACTAACAGCCAATTTAGGACAA
GGATGCGTTCCTGCAGGCCGCCAAGCGGACGCCGGTTGATCTCCAAGAATGGGCCATCAGCATGATGGAGCGACA
CAACCGCAAGTCGTATCTGGCTCCCCCGCCGCCCAAGTCGCTCAAGGACGAGCCCCCAGCTGCGCGATCGACTCC
GTCCCCGAAGCCTCAACCCCAGCAGCAGCCCAGCAGCAAGCCGATGCGCACTCCCCAGTACGCCCCCAGCGACAT
TCCCTCCAGCGTGGGCCGCAACAGCCCCTCGCAGTACCAGTACAACTACGCCCCCGCCAACCCATCCCCGCGTCC
ACCCCGGTCAACACGCTCGCCTCCCATCTCTCTCGAGCATCTGTCGTTGGAAGATGAGTACCGCTCCGGCCGTCG
TCCCTCACGGACTCCCGTCGGGGGCCCCTCTTCCGGATTGGAACCCCCCATGAACCCGATGGGATCTCGTTCCGC
CAGCTCACACAACACGAAGTCGCGAATGCCTCTACAGTCAGCAGCGCTGCCCGTGCGAAACGCGCCTCCCCCGAG
CGGGCCTTCGCCCTCTGCTCCTGGAAATGGATCCTGGCAGCGCCAGCCAAACTCCATGCGCGGGGACCATATGAC
GGGTGCCGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail