Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g4609.t1
Gene name
Locationscaffold_029:92954..96032
Strand+
Gene length (bp)3078
Transcript length (bp)2745
Coding sequence length (bp)2745
Protein length (aa) 915

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01644 Chitin_synth_1 Chitin synthase 4.4E-69 225 393
PF08407 Chitin_synth_1N Chitin synthase N-terminal 1.1E-27 145 224
PF03142 Chitin_synth_2 Chitin synthase 2.7E-19 370 548
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 7.5E-08 373 596

GO

GO Term Description Terminal node
GO:0006031 chitin biosynthetic process Yes
GO:0004100 chitin synthase activity Yes
GO:0006023 aminoglycan biosynthetic process No
GO:1901073 glucosamine-containing compound biosynthetic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0006022 aminoglycan metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0016758 hexosyltransferase activity No
GO:0009059 macromolecule biosynthetic process No
GO:0009058 biosynthetic process No
GO:0003674 molecular_function No
GO:0016757 glycosyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0003824 catalytic activity No
GO:0006030 chitin metabolic process No
GO:0008375 acetylglucosaminyltransferase activity No
GO:0046349 amino sugar biosynthetic process No
GO:0016740 transferase activity No
GO:0006040 amino sugar metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901071 glucosamine-containing compound metabolic process No
GO:0008194 UDP-glycosyltransferase activity No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 543 562 19
2 583 605 22
3 625 647 22
4 660 682 22
5 707 729 22
6 843 860 17
7 880 902 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g4609.t1
MAYQGTGNHSPPGYDDGGHRLQDLPAGNNYEEEASRGLLSSQTGPFTGPFDDPQQRNLSPARPTSGYSLTETYAA
DAGYHDPYSAGGSVYSAQSGENPATAFGVPGRVASPYARSETSSTEAWRQRQAPGGAGSGGGGGLRRYATRKVKL
VQGSVLSVDYPVPSAIQNAIQAKYRNDLEGGSEEFTHMRYTAATCDPNEFTLHNGYNLRPAMYNRHTELLIAITY
YNEDKTLTARTLHGVMQNIRDIVNLKKSEFWNKGGPAWQKIVVCLVFDGIDPCDKDVLDVLATVGIYQDGVMKRD
VDGKETVAHIFEYTTQLSVTPNQQLIRPTDDGPSTLPPVQMMFCLKQKNSKKINSHRWLFNAFGRILNPEVCILL
DAGTKPGHKSLLALWEAFYNDKDLGGACGEIHAMLGKGWRNLINPLVAAQNFEYKISNILDKPLESSFGYVSVLP
GAFSAYRFRAIMGRPLEQYFHGDHTLSKQLGKKGIEGMNIFKKNMFLAEDRILCFELVAKAGSKWHLSYVKASKG
ETDVPEGAAEFISQRRRWLNGSFAAGIYSLMHFGRMYKSGHNIIRMFFLHIQMLYNTFSTILTWFSLASYWLTTS
VIMDLVGTPSASNGHTGFPFGKTATPIVNTIVKYAYLGFLLLQFILALGNRPKGSRFSYLASFVVFGIIQLYVVV
DALYLVVRAFSGSAPMDFDTTHGVGAFLGSFFGSTGAGIIIIALAATFGLYFVASFMYMDPWHMFTSFPQYMAVQ
SSYINILNVYAFSNWHDVSWGTKGSDKADALPSAKTTKEGGKETVIEEIDKPQADIDSQFEATVKRALTPYVAPV
EKDEKSLDDSYKSFRTRLVTFWIFSNALMAVCITSDGVDKFGFTNSATDRTSRFFQALLWSNAVVALFRFIGACW
FLGKTGVMCCFARR*
Coding >Ani_SJS72_1|g4609.t1
ATGGCCTACCAAGGCACTGGTAATCACTCGCCTCCCGGCTACGATGACGGTGGGCATCGGCTTCAGGATCTACCA
GCCGGCAACAACTATGAAGAAGAAGCGTCTAGAGGACTGCTATCGAGCCAAACGGGCCCATTCACAGGTCCCTTT
GATGACCCCCAGCAGCGCAATCTGTCCCCGGCTCGGCCCACCTCTGGATACAGCTTGACCGAGACATATGCTGCC
GATGCGGGTTATCATGATCCTTACAGTGCAGGTGGCTCGGTTTACTCTGCACAGTCTGGAGAGAACCCCGCGACT
GCCTTTGGCGTCCCCGGCCGTGTTGCTTCGCCCTATGCTCGTAGCGAAACCTCGTCAACAGAGGCTTGGCGCCAG
AGACAGGCTCCTGGAGGTGCTGGTAGTGGTGGCGGCGGTGGCCTGCGCCGTTACGCCACCAGAAAGGTCAAGCTT
GTGCAGGGCTCAGTCCTGAGTGTTGACTACCCGGTGCCTAGTGCTATTCAAAATGCAATCCAGGCAAAGTATAGG
AACGACCTGGAGGGCGGAAGCGAAGAATTCACACACATGCGATACACCGCAGCCACATGTGATCCTAACGAGTTC
ACCCTTCATAATGGCTATAACCTTCGTCCTGCCATGTACAACAGACACACCGAGTTGTTGATTGCTATTACGTAT
TACAACGAAGATAAGACGCTTACAGCCCGTACGCTGCATGGTGTGATGCAAAACATTCGTGACATTGTGAACTTG
AAGAAGTCTGAGTTCTGGAACAAGGGTGGGCCAGCCTGGCAGAAGATTGTGGTCTGCCTGGTGTTTGATGGTATT
GATCCCTGTGACAAGGATGTGCTGGATGTCTTGGCCACCGTTGGTATTTACCAGGATGGTGTCATGAAGCGTGAT
GTTGATGGAAAGGAAACCGTTGCTCATATCTTCGAATACACGACGCAATTATCCGTTACCCCCAACCAGCAGCTC
ATTCGCCCGACAGATGACGGTCCTAGCACACTACCTCCTGTTCAGATGATGTTCTGTTTGAAGCAGAAGAACAGC
AAGAAGATCAACTCTCATAGATGGCTTTTCAACGCTTTCGGCCGTATCCTGAACCCCGAGGTCTGCATTCTTCTC
GATGCTGGTACCAAGCCTGGTCACAAGTCACTCTTGGCCCTGTGGGAGGCCTTCTACAACGACAAGGACCTCGGA
GGTGCTTGTGGTGAAATTCACGCCATGTTGGGTAAGGGTTGGAGAAACCTGATCAACCCTCTCGTTGCCGCCCAG
AACTTCGAATATAAAATCAGTAACATCCTCGACAAGCCGTTGGAGAGTTCTTTCGGCTATGTCAGTGTGTTGCCT
GGTGCTTTCTCAGCATACCGATTCCGTGCCATCATGGGCCGCCCACTGGAGCAGTATTTCCATGGTGATCATACG
CTCTCTAAACAGCTGGGCAAGAAGGGTATCGAGGGAATGAACATTTTCAAGAAGAACATGTTCTTGGCCGAGGAC
CGTATCTTGTGTTTCGAGCTGGTTGCTAAGGCTGGCTCAAAATGGCATTTGTCATACGTTAAAGCCTCAAAGGGT
GAAACTGACGTGCCTGAAGGTGCTGCTGAGTTCATCTCGCAGCGTCGTCGTTGGTTGAACGGATCCTTCGCAGCC
GGTATCTATTCGCTCATGCATTTCGGACGGATGTATAAGAGTGGCCACAACATCATTCGAATGTTCTTCCTTCAT
ATTCAGATGTTGTACAACACTTTCTCGACTATTCTTACATGGTTCTCTCTGGCATCCTATTGGCTTACAACATCG
GTCATTATGGACCTGGTCGGTACTCCTAGTGCTAGCAACGGTCACACAGGTTTCCCCTTTGGCAAAACGGCAACT
CCCATCGTCAACACGATTGTCAAATATGCCTACCTTGGTTTCCTGCTCCTCCAGTTCATTCTCGCTTTGGGTAAC
CGTCCGAAAGGTTCCCGTTTCTCGTACCTCGCATCCTTCGTTGTCTTCGGTATCATTCAGCTCTACGTTGTCGTC
GATGCACTATACCTGGTAGTCCGCGCTTTCAGTGGCAGTGCTCCGATGGACTTTGATACCACGCACGGTGTTGGT
GCATTCCTTGGTTCGTTCTTCGGGTCGACAGGTGCCGGTATCATTATCATTGCGCTTGCTGCCACTTTCGGTCTC
TACTTCGTGGCTTCGTTCATGTACATGGACCCGTGGCACATGTTCACCTCGTTCCCTCAGTACATGGCCGTGCAG
TCTTCTTACATCAACATTCTCAACGTCTATGCCTTCAGCAACTGGCACGATGTGTCTTGGGGTACCAAGGGTTCT
GATAAGGCGGATGCTCTTCCCTCCGCGAAGACTACCAAGGAAGGGGGCAAGGAGACCGTCATTGAGGAAATTGAC
AAGCCTCAGGCCGATATTGACAGCCAATTTGAAGCTACGGTGAAGCGTGCTTTGACACCATATGTGGCTCCCGTG
GAGAAGGATGAGAAGAGTTTGGATGACTCGTACAAGAGCTTCCGTACGAGATTGGTGACGTTCTGGATCTTCAGT
AACGCTCTAATGGCTGTTTGCATCACCAGCGATGGTGTGGATAAGTTTGGCTTCACAAACTCTGCCACCGATCGT
ACGTCACGCTTCTTCCAGGCCCTACTGTGGTCAAACGCCGTTGTTGCGCTTTTCCGCTTCATCGGAGCCTGCTGG
TTCCTGGGTAAGACCGGTGTGATGTGTTGCTTTGCCCGCCGCTAG
Transcript >Ani_SJS72_1|g4609.t1
ATGGCCTACCAAGGCACTGGTAATCACTCGCCTCCCGGCTACGATGACGGTGGGCATCGGCTTCAGGATCTACCA
GCCGGCAACAACTATGAAGAAGAAGCGTCTAGAGGACTGCTATCGAGCCAAACGGGCCCATTCACAGGTCCCTTT
GATGACCCCCAGCAGCGCAATCTGTCCCCGGCTCGGCCCACCTCTGGATACAGCTTGACCGAGACATATGCTGCC
GATGCGGGTTATCATGATCCTTACAGTGCAGGTGGCTCGGTTTACTCTGCACAGTCTGGAGAGAACCCCGCGACT
GCCTTTGGCGTCCCCGGCCGTGTTGCTTCGCCCTATGCTCGTAGCGAAACCTCGTCAACAGAGGCTTGGCGCCAG
AGACAGGCTCCTGGAGGTGCTGGTAGTGGTGGCGGCGGTGGCCTGCGCCGTTACGCCACCAGAAAGGTCAAGCTT
GTGCAGGGCTCAGTCCTGAGTGTTGACTACCCGGTGCCTAGTGCTATTCAAAATGCAATCCAGGCAAAGTATAGG
AACGACCTGGAGGGCGGAAGCGAAGAATTCACACACATGCGATACACCGCAGCCACATGTGATCCTAACGAGTTC
ACCCTTCATAATGGCTATAACCTTCGTCCTGCCATGTACAACAGACACACCGAGTTGTTGATTGCTATTACGTAT
TACAACGAAGATAAGACGCTTACAGCCCGTACGCTGCATGGTGTGATGCAAAACATTCGTGACATTGTGAACTTG
AAGAAGTCTGAGTTCTGGAACAAGGGTGGGCCAGCCTGGCAGAAGATTGTGGTCTGCCTGGTGTTTGATGGTATT
GATCCCTGTGACAAGGATGTGCTGGATGTCTTGGCCACCGTTGGTATTTACCAGGATGGTGTCATGAAGCGTGAT
GTTGATGGAAAGGAAACCGTTGCTCATATCTTCGAATACACGACGCAATTATCCGTTACCCCCAACCAGCAGCTC
ATTCGCCCGACAGATGACGGTCCTAGCACACTACCTCCTGTTCAGATGATGTTCTGTTTGAAGCAGAAGAACAGC
AAGAAGATCAACTCTCATAGATGGCTTTTCAACGCTTTCGGCCGTATCCTGAACCCCGAGGTCTGCATTCTTCTC
GATGCTGGTACCAAGCCTGGTCACAAGTCACTCTTGGCCCTGTGGGAGGCCTTCTACAACGACAAGGACCTCGGA
GGTGCTTGTGGTGAAATTCACGCCATGTTGGGTAAGGGTTGGAGAAACCTGATCAACCCTCTCGTTGCCGCCCAG
AACTTCGAATATAAAATCAGTAACATCCTCGACAAGCCGTTGGAGAGTTCTTTCGGCTATGTCAGTGTGTTGCCT
GGTGCTTTCTCAGCATACCGATTCCGTGCCATCATGGGCCGCCCACTGGAGCAGTATTTCCATGGTGATCATACG
CTCTCTAAACAGCTGGGCAAGAAGGGTATCGAGGGAATGAACATTTTCAAGAAGAACATGTTCTTGGCCGAGGAC
CGTATCTTGTGTTTCGAGCTGGTTGCTAAGGCTGGCTCAAAATGGCATTTGTCATACGTTAAAGCCTCAAAGGGT
GAAACTGACGTGCCTGAAGGTGCTGCTGAGTTCATCTCGCAGCGTCGTCGTTGGTTGAACGGATCCTTCGCAGCC
GGTATCTATTCGCTCATGCATTTCGGACGGATGTATAAGAGTGGCCACAACATCATTCGAATGTTCTTCCTTCAT
ATTCAGATGTTGTACAACACTTTCTCGACTATTCTTACATGGTTCTCTCTGGCATCCTATTGGCTTACAACATCG
GTCATTATGGACCTGGTCGGTACTCCTAGTGCTAGCAACGGTCACACAGGTTTCCCCTTTGGCAAAACGGCAACT
CCCATCGTCAACACGATTGTCAAATATGCCTACCTTGGTTTCCTGCTCCTCCAGTTCATTCTCGCTTTGGGTAAC
CGTCCGAAAGGTTCCCGTTTCTCGTACCTCGCATCCTTCGTTGTCTTCGGTATCATTCAGCTCTACGTTGTCGTC
GATGCACTATACCTGGTAGTCCGCGCTTTCAGTGGCAGTGCTCCGATGGACTTTGATACCACGCACGGTGTTGGT
GCATTCCTTGGTTCGTTCTTCGGGTCGACAGGTGCCGGTATCATTATCATTGCGCTTGCTGCCACTTTCGGTCTC
TACTTCGTGGCTTCGTTCATGTACATGGACCCGTGGCACATGTTCACCTCGTTCCCTCAGTACATGGCCGTGCAG
TCTTCTTACATCAACATTCTCAACGTCTATGCCTTCAGCAACTGGCACGATGTGTCTTGGGGTACCAAGGGTTCT
GATAAGGCGGATGCTCTTCCCTCCGCGAAGACTACCAAGGAAGGGGGCAAGGAGACCGTCATTGAGGAAATTGAC
AAGCCTCAGGCCGATATTGACAGCCAATTTGAAGCTACGGTGAAGCGTGCTTTGACACCATATGTGGCTCCCGTG
GAGAAGGATGAGAAGAGTTTGGATGACTCGTACAAGAGCTTCCGTACGAGATTGGTGACGTTCTGGATCTTCAGT
AACGCTCTAATGGCTGTTTGCATCACCAGCGATGGTGTGGATAAGTTTGGCTTCACAAACTCTGCCACCGATCGT
ACGTCACGCTTCTTCCAGGCCCTACTGTGGTCAAACGCCGTTGTTGCGCTTTTCCGCTTCATCGGAGCCTGCTGG
TTCCTGGGTAAGACCGGTGTGATGTGTTGCTTTGCCCGCCGCTAG
Gene >Ani_SJS72_1|g4609.t1
ATGGCCTACCAAGGCACTGGTAATCACTCGCCTCCCGGCTACGATGACGGTGGGCATCGGCTTCAGGATCTACCA
GCCGGCAACAACGTAAGTCTTCATTCTTTGTGGCCGTGTGATGTTGCGCCTGTACGAAAACAATCAGTTAACATG
AGAATCTGGATGATCTCTAGTATGAAGAAGAAGCGTCTAGAGGACTGCTATCGAGCCAAACGGGCCCATTCACAG
GTCCCTTTGATGACCCCCAGCAGCGCAATCTGTCCCCGGCTCGGCCCACCTCTGGATACAGCTTGACCGAGACAT
ATGCTGCCGATGCGGGTTATCATGATCCTTACAGTGCAGGTGGCTCGGTTTACTCTGCACAGTCTGGAGAGAACC
CCGCGACTGCCTTTGGCGTCCCCGGCCGTGTTGCTTCGCCCTATGCTCGTAGCGAAACCTCGTCAACAGAGGCTT
GGCGCCAGAGACAGGCTCCTGGAGGTGCTGGTAGTGGTGGCGGCGGTGGCCTGCGCCGTTACGCCACCAGAAAGG
TCAAGCTTGTGCAGGGCTCAGTCCTGAGTGTTGACTACCCGGTGCCTAGTGCTATTCAAAATGCAATCCAGGCAA
AGTATAGGAACGACCTGGAGGGCGGAAGCGAAGAATTCACACACATGCGATGTAAGTTACCGCACGGCCCAATCA
TGCAGCTGCTCGGAACTAACGGAGAATTGCCTTGGTATAGACACCGCAGCCACATGTGATCCTAACGAGTTCACC
CTTCATAATGGCTATAACCTTCGTCCTGCCATGTACAACAGACACACCGAGTTGTTGATTGCTATTACGTATTAC
AACGAAGATAAGACGCTTACAGCCCGTACGCTGCATGGTGTGATGCAAAACATTCGTGACATTGTGAACTTGAAG
AAGTCTGAGTTCTGGAACAAGGGTGGGCCAGCCTGGCAGAAGATTGTGGTCTGCCTGGTGTTTGATGGTATTGAT
CCCTGTGACAAGGATGTGCTGGATGTCTTGGCCACCGTTGGTATTTACCAGGATGGTGTCATGAAGCGTGATGTT
GATGGAAAGGAAACCGTTGCTCATATCGTACGCGGAATCCCAGAATATACACATGTGGAATGTGCTAACAGCTGA
TAGTTCGAATACACGACGCAATTATCCGTTACCCCCAACCAGCAGCTCATTCGCCCGACAGATGACGGTCCTAGC
ACACTACCTCCTGTTCAGATGATGTTCTGTTTGAAGCAGAAGAACAGCAAGAAGATCAACTCTCATAGATGGCTT
TTCAACGCTTTCGGCCGTATCCTGAACCCCGAGGTCTGCATTCTTCTCGATGCTGGTACCAAGCCTGGTCACAAG
TCACTCTTGGCCCTGTGGGAGGCCTTCTACAACGACAAGGACCTCGGAGGTGCTTGTGGTGAAATTCACGCCATG
TTGGGTAAGGGTTGGAGAAACCTGATCAACCCTCTCGTTGCCGCCCAGAACTTCGAATATAAAATCAGTAACATC
CTCGACAAGCCGTTGGAGAGTTCTTTCGGCTATGTCAGTGTGTTGCCTGGTGCTTTCTCAGCATACCGATTCCGT
GCCATCATGGGCCGCCCACTGGAGCAGTATTTCCATGGTGATCATACGCTCTCTAAACAGCTGGGCAAGAAGGGT
ATCGAGGGAATGAACATTTTCAAGAAGAACATGTTCTTGGCCGAGGACCGTATCTTGTGTTTCGAGCTGGTTGCT
AAGGCTGGCTCAAAATGGCATTTGTCATACGTTAAAGCCTCAAAGGGTGAAACTGACGTGCCTGAAGGTGCTGCT
GAGTTCATCTCGCAGCGTCGTCGTTGGTTGAACGGATCCTTCGCAGCCGGTATCTATTCGCTCATGCATTTCGGA
CGGATGTATAAGAGTGGCCACAACATCATTCGAATGTTCTTCCTTCATATTCAGATGTTGTACAACACTTTCTCG
ACTATTCTTACATGGTTCTCTCTGGGTATGTTTCGCGGTCCTTTTCGACTATAGCATAAACTTGAGAGCTTTTAC
TGACTTTCGGCAACCAGCATCCTATTGGCTTACAACATCGGTCATTATGGACCTGGTCGGTACTCCTAGTGCTAG
CAACGGTCACACAGGTTTCCCCTTTGGCAAAACGGCAACTCCCATCGTCAACACGATTGTCAAATATGCCTACCT
TGGTTTCCTGCTCCTCCAGTTCATTCTCGCTTTGGGTAACCGTCCGAAAGGTTCCCGTTTCTCGTACCTCGCATC
CTTCGTTGTCTTCGGTATCATTCAGCTCTACGTTGTCGTCGATGCACTATACCTGGTAGTCCGCGCTTTCAGTGG
CAGTGCTCCGATGGACTTTGATACCACGCACGGTGTTGGTGCATTCCTTGGTTCGTTCTTCGGGTCGACAGGTGC
CGGTATCATTATCATTGCGCTTGCTGCCACTTTCGGTCTCTACTTCGTGGCTTCGTTCATGTACATGGACCCGTG
GCACATGTTCACCTCGTTCCCTCAGTACATGGCCGTGCAGTCTTCTTACATCAACATTCTCAACGTCTATGCCTT
CAGCAACTGGCACGATGTGTCTTGGGGTACCAAGGGTTCTGATAAGGCGGATGCTCTTCCCTCCGCGAAGACTAC
CAAGGAAGGGGGCAAGGAGACCGTCATTGAGGAAATTGACAAGCCTCAGGCCGATATTGACAGCCAATTTGAAGC
TACGGTGAAGCGTGCTTTGACACCATATGTGGCTCCCGTGGAGAAGGATGAGAAGAGTTTGGATGACTCGTACAA
GAGCTTCCGTACGAGATTGGTGACGTTCTGGATCTTCAGTAACGCTCTAATGGCTGTTTGCATCACCAGCGATGG
TGTGGATAAGTTTGGCTTCACAGTACGTATATCCCCTACACCAAACGAAGTCTTGATGCCCAAAAAGACAAAACT
AACGGCTTGGTCCAGAACTCTGCCACCGATCGTACGTCACGCTTCTTCCAGGCCCTACTGTGGTCAAACGCCGTT
GTTGCGCTTTTCCGCTTCATCGGAGCCTGCTGGTTCCTGGGTAAGACCGGTGTGATGTGTTGCTTTGCCCGCCGC
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail