Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g4185.t1
Gene name
Locationscaffold_025:140404..142409
Strand+
Gene length (bp)2005
Transcript length (bp)1440
Coding sequence length (bp)1440
Protein length (aa) 480

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.1E-34 34 400

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 32 54 22
2 67 89 22
3 102 124 22
4 156 178 22
5 193 215 22
6 260 282 22
7 292 314 22
8 321 343 22
9 348 370 22
10 382 404 22
11 414 436 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g4185.t1
MALFTDPDALEEPVDPAEVRKLLWKIDFMILPYLAVCYAFFYIDKTTLSYAAIFGIEEDLNLHGTQYSWLSSIFY
FGFLAWAFPTNFLLQRLPIGKYLGANIFMWGVFLIIQAACHNFATLAVLRALGGAAEACSDPAFMLITSMWYTRR
EQPVRLGLWYTANGLGIALGGLLGYGIGHIRGALPSWKYEFIVIGSLCAAWGIVMFIILPDSPVTAPLLTKRQRR
IAVERVRENQTGIENKHIKPHQIWEAFTDYKLYFFFFLGVVCNIPNGGISNFGTIIIQGFGFSTLVTTLMQIPYG
VIIALSILLCVYLNDRFENRRCIFILIFLLPNIAGAFGLRFVPQHVKVGRLICYYLTGPYNAAFVLILSMQIANT
AGHTKKVVTNAVLFLGYCTGNIAGPFFYKESQKPTYDLGIWSMIVCHLIEVVLISALGLLLRWENKRRDRIQSQM
AGGLEGRDLDSTAFLDLTDRENLNFRYIY*
Coding >Ani_SJS72_1|g4185.t1
ATGGCTCTTTTTACTGATCCAGATGCGCTTGAGGAGCCTGTTGATCCGGCGGAAGTAAGAAAGCTACTGTGGAAG
ATTGACTTCATGATCCTGCCATATCTTGCCGTTTGCTATGCCTTCTTTTACATCGACAAGACAACACTGAGCTAC
GCAGCAATTTTTGGAATTGAGGAAGACCTCAATCTCCATGGCACACAATATAGCTGGCTATCAAGTATCTTCTAC
TTCGGTTTTCTGGCTTGGGCATTTCCCACTAACTTTCTTCTGCAACGCTTACCAATTGGAAAGTATCTTGGTGCC
AATATCTTCATGTGGGGAGTATTTCTCATTATACAGGCAGCATGCCATAACTTCGCAACGCTCGCTGTCCTGCGA
GCCCTAGGTGGTGCAGCAGAGGCGTGCTCGGACCCTGCTTTCATGCTCATCACTAGTATGTGGTATACGCGACGT
GAACAGCCGGTACGCTTAGGATTATGGTACACCGCCAATGGCTTGGGAATCGCACTTGGTGGTCTTCTTGGCTAT
GGAATTGGACATATCAGAGGTGCCCTTCCTTCGTGGAAGTACGAATTCATCGTAATTGGATCTCTTTGTGCGGCC
TGGGGAATAGTCATGTTCATCATCCTGCCTGATTCGCCAGTCACTGCGCCGCTTCTCACCAAGCGGCAGCGTCGA
ATCGCAGTGGAAAGAGTGCGGGAAAACCAGACGGGTATCGAGAATAAGCATATCAAGCCGCATCAGATCTGGGAA
GCATTCACGGACTACAAGCTCTACTTTTTCTTTTTCTTGGGTGTAGTTTGTAACATTCCCAACGGTGGCATCTCG
AACTTTGGAACCATTATCATCCAAGGGTTTGGATTCTCGACGCTCGTGACAACCTTGATGCAGATCCCTTATGGA
GTCATAATTGCACTATCCATCCTCCTCTGCGTCTACCTTAACGACCGCTTCGAGAACAGGCGTTGCATCTTCATC
TTGATCTTCCTCCTCCCGAACATTGCAGGAGCATTTGGGCTACGCTTCGTCCCACAGCATGTCAAGGTCGGCCGC
TTGATTTGTTACTACTTGACGGGGCCATACAATGCTGCCTTCGTGCTGATTCTTAGTATGCAAATCGCAAACACA
GCCGGACACACGAAAAAGGTCGTCACCAACGCAGTCCTCTTCCTAGGCTACTGTACCGGTAACATCGCAGGTCCT
TTCTTCTACAAAGAGAGTCAGAAGCCAACATATGATCTGGGGATCTGGTCAATGATCGTCTGCCACCTTATCGAA
GTCGTGCTCATTTCTGCGCTCGGTCTTCTGCTTCGTTGGGAGAACAAACGCCGTGATCGAATCCAGTCTCAGATG
GCTGGTGGTCTGGAGGGGAGAGATTTGGATTCCACTGCCTTTTTGGATTTGACGGATCGGGAGAATCTCAACTTT
CGGTATATTTACTAG
Transcript >Ani_SJS72_1|g4185.t1
ATGGCTCTTTTTACTGATCCAGATGCGCTTGAGGAGCCTGTTGATCCGGCGGAAGTAAGAAAGCTACTGTGGAAG
ATTGACTTCATGATCCTGCCATATCTTGCCGTTTGCTATGCCTTCTTTTACATCGACAAGACAACACTGAGCTAC
GCAGCAATTTTTGGAATTGAGGAAGACCTCAATCTCCATGGCACACAATATAGCTGGCTATCAAGTATCTTCTAC
TTCGGTTTTCTGGCTTGGGCATTTCCCACTAACTTTCTTCTGCAACGCTTACCAATTGGAAAGTATCTTGGTGCC
AATATCTTCATGTGGGGAGTATTTCTCATTATACAGGCAGCATGCCATAACTTCGCAACGCTCGCTGTCCTGCGA
GCCCTAGGTGGTGCAGCAGAGGCGTGCTCGGACCCTGCTTTCATGCTCATCACTAGTATGTGGTATACGCGACGT
GAACAGCCGGTACGCTTAGGATTATGGTACACCGCCAATGGCTTGGGAATCGCACTTGGTGGTCTTCTTGGCTAT
GGAATTGGACATATCAGAGGTGCCCTTCCTTCGTGGAAGTACGAATTCATCGTAATTGGATCTCTTTGTGCGGCC
TGGGGAATAGTCATGTTCATCATCCTGCCTGATTCGCCAGTCACTGCGCCGCTTCTCACCAAGCGGCAGCGTCGA
ATCGCAGTGGAAAGAGTGCGGGAAAACCAGACGGGTATCGAGAATAAGCATATCAAGCCGCATCAGATCTGGGAA
GCATTCACGGACTACAAGCTCTACTTTTTCTTTTTCTTGGGTGTAGTTTGTAACATTCCCAACGGTGGCATCTCG
AACTTTGGAACCATTATCATCCAAGGGTTTGGATTCTCGACGCTCGTGACAACCTTGATGCAGATCCCTTATGGA
GTCATAATTGCACTATCCATCCTCCTCTGCGTCTACCTTAACGACCGCTTCGAGAACAGGCGTTGCATCTTCATC
TTGATCTTCCTCCTCCCGAACATTGCAGGAGCATTTGGGCTACGCTTCGTCCCACAGCATGTCAAGGTCGGCCGC
TTGATTTGTTACTACTTGACGGGGCCATACAATGCTGCCTTCGTGCTGATTCTTAGTATGCAAATCGCAAACACA
GCCGGACACACGAAAAAGGTCGTCACCAACGCAGTCCTCTTCCTAGGCTACTGTACCGGTAACATCGCAGGTCCT
TTCTTCTACAAAGAGAGTCAGAAGCCAACATATGATCTGGGGATCTGGTCAATGATCGTCTGCCACCTTATCGAA
GTCGTGCTCATTTCTGCGCTCGGTCTTCTGCTTCGTTGGGAGAACAAACGCCGTGATCGAATCCAGTCTCAGATG
GCTGGTGGTCTGGAGGGGAGAGATTTGGATTCCACTGCCTTTTTGGATTTGACGGATCGGGAGAATCTCAACTTT
CGGTATATTTACTAG
Gene >Ani_SJS72_1|g4185.t1
ATGGCTCTTTTTACTGATCCAGATGCGCTTGAGGAGCCTGTTGATCCGGCGGAAGTAAGAAAGCTACTGTGGAAG
ATTGACTTCATGATCCTGCCATATCTTGCCGTTTGCTATGCCTTCTTTTACATCGACAAGGTACGCTGCTCTATA
CAACTTAATACGTTCATCCTTGCAGCGGCTGATTATAACCTGCAATAGACAACACTGAGCTACGCAGCAATTTTT
GGAATTGAGGAAGACCTCAATCTCCATGGCACACAATATAGCTGGCTATCAAGTATCTTCTACTTCGGTTTTCTG
GCTTGGGCATTTGTGAGTTCAATTAGCTGGGAAATGAGATCCAAATGTTAACATCCCATTAGCCCACTAACTTTC
TTCTGCAACGCTTACCAATTGGTAAGAGCCAGGCTTTCTGTGGTGAGATACGGACTAACTGTGCCGTCTAGGAAA
GTATCTTGGTGCCAATATCTTCATGTGGTACGTGGATTAACGGGCTTGTTTGTATGAAAGGTATGCTAAACTTAT
GCAGGGGAGTATTTCTCATTATACAGGCAGCATGCCATAACTTCGCAACGCTCGCTGTCCTGCGAGCCCTAGGTG
GTGCAGCAGAGGCGTGCTCGGACCCTGCTTTCATGCTCATCACTAGTATGTGGTATACGCGACGTGAACAGCCGG
TACGCTTAGGATTATGGTACACCGCCAATGGCTTGGGAATCGCACTTGGTGGTCTTCTTGGCTATGGAATTGGAC
ATATCAGAGGTGCCCTTCCTTCGTGGAAGTACGAATTCATCGTAATGTAAGATATTGCCTTGAATCTTGATCCTT
GGAGCGCTGCTAATCAGCTATCGTCAGTGGATCTCTTTGTGCGGCCTGGGGAATAGTCATGTTCATCATCCTGCC
TGATTCGCCAGTCACTGCGCCGCTTCTCACCAAGCGGCAGCGTCGAATCGCAGTGGAAAGAGTGCGGGAAAACCA
GACGGGTATCGAGAATAAGCATATCAAGCCGCATCAGATCTGGGAAGCATTCACGGACTACAAGCTCTACTTTTT
CTTTTTCTTGGGTGTAGTTTGTGAGTCACGGTTTTGCAGCATTCGAAGGTTGTACGCTGATAGACTGTTGACAGG
TAACATTCCCAACGGTGGCATCTCGAACTTTGGAACCATTATCATCCAAGGGTTTGGATTCTCGACGCTCGTGAC
AACCTTGATGCAGGTATGTGAAGTGCTCAAGACAGATAGTATGGAGTAAACATTAACGGCATAGATCCCTTATGG
AGTCATAATTGCACTATCCATCCTCCTCTGCGTCTACCTTAACGACCGCTTCGAGAACAGGCGTTGCATCTTCAT
CTTGATCTTCCTCCTCCCGAACATTGCAGGAGCATTTGGGCTACGCTTCGTCCCACAGCATGTCAAGGTCGGCCG
CTTGATTTGTTACTACTTGACGGGGCCATACAATGCTGCCTTCGTGCTGATTCTTAGTATGCAAATCGCAAACAC
AGCCGGTACGTTATCCTATCCTCCATTAATCAAGAAATTAGTCGAAACTGACGTTGCATAGGACACACGAAAAAG
GTCGTCACCAACGCAGTCCTCTTCCTAGGCTACTGTACCGGTAACATCGCAGGTCCTTTCTTCTACAAAGAGAGT
CAGAAGTAAGCTTTATCCCCACCCCCCAGAGCAATGGAATAGCACTAAAACATTGGGATAACAGGCCAACATATG
ATCTGGGGATCTGGTCAATGATCGTCTGCCACCTTATCGAAGTCGTGCTCATTTCTGCGCTCGGTCTTCTGCTTC
GTTGGGAGAACAAACGCCGTGATCGAATCCAGTCTCAGATGGCTGGTGGTCTGGAGGGGAGAGATTTGGATTCCA
CTGCCTTTTTGGATTTGACGGATCGGGAGAATCTCAAGTATGACCCTTTCCCCCTTCTCCCATACACGGTCTGCT
ATGGTATATATGGGTGCTAACTGCTGTTTTTGATAGCTTTCGGTATATTTACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail