Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g4128.t1
Gene name
Locationscaffold_024:306586..309068
Strand+
Gene length (bp)2482
Transcript length (bp)2076
Coding sequence length (bp)2076
Protein length (aa) 692

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17168 DUF5127 Domain of unknown function (DUF5127) 2.3E-82 103 335
PF16335 DUF4965 Domain of unknown function (DUF4965) 7.8E-78 340 510
PF08760 DUF1793 Domain of unknown function (DUF1793) 4.6E-64 516 685

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g4128.t1
MYQFFISLLVTVLASSARATSVFSPARPPAIPLAVKSPYLSTWLSAGSDGGNGGYLAGEWPIFWSGQITGWAGMI
RVDGSAYTWMGIPGPATVNQTSYEYTSTKSIFTMNVANKVEMNITFLSPITPNDYKRQSLVFSYVDVQVESLDGQ
PHDVQLYADISAEWVSGDRTTTATWDYGTTDNGVAYHKVSRQTQLAFSEVSDQGEWGDWYWATDNSENLTYQSGI
ADNVRAAFAANGTLGDSQDSDYRAISTDWPIFAFAHDLGSVESAVSVLYSIGLAQTDAIQYEGSSSGSTILPSLW
TSYFSTGPEALDFFHNDYATSSSLSSDLDSQIAQDSVAAAGQDYLTITSLTVRQAFGACQLCGTPDNTYLFMKEI
SSDGNVNTVDVIFPAHPIFLYTNPELLNLLLKPLFEIQESGNYPNAYAMHDVGSHYPNATGHPKGDDEAMPLEEC
GNMVIMALAYAQKASDTDYLSQHYTLLNQWTAYLVEDAIYPANQISTDDFAGSLANQTNLALKGIIGIEAMAVIS
NETDHSANGANYTAIAHNYIDRWQILGIAHNANPPHATLAYGSNNSHGLLYNLYADRELGLNLVPQSVYDMQSTF
YPTVQLEYGVPLDTRHEYTKADWEMFTAAIASTSTRDMFMQLLSKWINDTPTNYAMTDLYDAVGGGYPTNVFIDR
PVVGGAFALLLLNQGN*
Coding >Ani_SJS72_1|g4128.t1
ATGTATCAATTTTTCATAAGTTTATTGGTGACGGTGCTGGCCTCTTCGGCCAGGGCTACCTCTGTCTTCTCGCCT
GCCCGTCCTCCTGCGATACCGCTAGCCGTCAAATCGCCTTACCTGAGCACCTGGCTGTCTGCAGGCAGCGATGGA
GGCAACGGTGGCTATCTTGCGGGAGAATGGCCGATTTTCTGGTCTGGCCAGATTACTGGCTGGGCTGGAATGATT
CGTGTTGATGGCAGTGCTTACACCTGGATGGGAATCCCTGGACCGGCGACTGTGAACCAAACTTCCTATGAGTAC
ACCTCTACGAAAAGTATCTTCACCATGAATGTCGCCAACAAGGTGGAGATGAATATTACGTTCCTTTCGCCAATT
ACACCAAACGATTACAAACGCCAGTCGCTCGTTTTCTCCTATGTCGATGTGCAAGTTGAATCTCTCGATGGCCAG
CCCCACGATGTGCAGCTGTATGCTGATATTTCGGCGGAATGGGTGTCGGGAGACCGGACCACGACTGCAACATGG
GATTACGGTACCACCGATAATGGTGTCGCCTATCACAAAGTCAGTCGCCAAACCCAGCTCGCTTTCTCCGAGGTC
AGTGACCAAGGAGAATGGGGAGACTGGTACTGGGCCACAGACAACAGTGAAAACCTGACCTACCAGTCTGGTATA
GCCGATAATGTCCGTGCAGCATTTGCTGCGAACGGAACGCTAGGCGACTCACAGGATTCTGACTATCGTGCCATA
TCTACCGACTGGCCTATCTTTGCATTTGCTCATGACCTTGGATCTGTGGAATCCGCAGTCTCGGTTCTATACTCT
ATTGGTCTGGCACAAACCGACGCAATCCAGTACGAAGGAAGTAGCAGTGGATCCACCATTCTACCTTCGCTGTGG
ACCAGCTATTTCAGCACGGGGCCGGAAGCTCTGGATTTCTTCCATAATGACTATGCTACATCCTCATCGCTCTCG
TCGGATCTTGATTCTCAGATAGCCCAGGATTCCGTTGCTGCAGCTGGCCAGGACTACCTGACAATCACTTCTCTC
ACGGTTCGTCAGGCTTTTGGTGCATGCCAGCTGTGCGGAACCCCGGACAACACCTACCTGTTCATGAAGGAAATC
TCGTCCGATGGAAACGTGAACACGGTCGACGTTATCTTCCCAGCGCACCCCATCTTCTTGTACACGAACCCTGAG
CTTCTTAACCTGCTGTTGAAGCCACTTTTCGAGATCCAGGAGTCTGGGAACTACCCCAACGCATACGCCATGCAC
GATGTAGGGAGCCACTATCCCAACGCTACTGGCCATCCTAAAGGCGATGATGAGGCGATGCCACTGGAAGAATGT
GGCAACATGGTTATCATGGCCTTGGCATATGCGCAGAAGGCAAGCGACACGGATTACCTGTCCCAGCATTATACC
TTGCTCAACCAGTGGACGGCGTACCTTGTGGAGGATGCAATCTACCCTGCCAACCAAATCTCGACAGATGACTTT
GCAGGCAGCTTGGCGAACCAGACCAACTTGGCCTTGAAGGGCATCATCGGTATCGAAGCCATGGCTGTGATTAGC
AACGAGACTGATCACTCTGCTAATGGAGCCAACTACACTGCCATTGCTCATAATTACATCGACCGATGGCAAATT
TTGGGCATCGCGCACAATGCCAACCCTCCTCATGCAACACTTGCTTATGGCTCCAACAACAGCCACGGTCTCCTA
TACAACCTCTATGCTGATCGCGAGCTGGGCCTAAACTTGGTCCCACAGTCCGTATACGACATGCAGAGTACATTC
TACCCCACTGTTCAACTAGAGTACGGAGTACCGCTCGACACTAGACACGAATACACAAAAGCCGATTGGGAAATG
TTTACTGCGGCCATTGCATCAACCAGTACTCGAGACATGTTCATGCAGCTTCTATCAAAGTGGATCAACGACACA
CCCACAAACTACGCAATGACTGATCTCTACGATGCAGTTGGCGGGGGCTACCCAACCAACGTCTTCATCGACCGT
CCCGTCGTGGGAGGTGCCTTTGCCTTGCTTCTGCTCAACCAAGGCAACTAA
Transcript >Ani_SJS72_1|g4128.t1
ATGTATCAATTTTTCATAAGTTTATTGGTGACGGTGCTGGCCTCTTCGGCCAGGGCTACCTCTGTCTTCTCGCCT
GCCCGTCCTCCTGCGATACCGCTAGCCGTCAAATCGCCTTACCTGAGCACCTGGCTGTCTGCAGGCAGCGATGGA
GGCAACGGTGGCTATCTTGCGGGAGAATGGCCGATTTTCTGGTCTGGCCAGATTACTGGCTGGGCTGGAATGATT
CGTGTTGATGGCAGTGCTTACACCTGGATGGGAATCCCTGGACCGGCGACTGTGAACCAAACTTCCTATGAGTAC
ACCTCTACGAAAAGTATCTTCACCATGAATGTCGCCAACAAGGTGGAGATGAATATTACGTTCCTTTCGCCAATT
ACACCAAACGATTACAAACGCCAGTCGCTCGTTTTCTCCTATGTCGATGTGCAAGTTGAATCTCTCGATGGCCAG
CCCCACGATGTGCAGCTGTATGCTGATATTTCGGCGGAATGGGTGTCGGGAGACCGGACCACGACTGCAACATGG
GATTACGGTACCACCGATAATGGTGTCGCCTATCACAAAGTCAGTCGCCAAACCCAGCTCGCTTTCTCCGAGGTC
AGTGACCAAGGAGAATGGGGAGACTGGTACTGGGCCACAGACAACAGTGAAAACCTGACCTACCAGTCTGGTATA
GCCGATAATGTCCGTGCAGCATTTGCTGCGAACGGAACGCTAGGCGACTCACAGGATTCTGACTATCGTGCCATA
TCTACCGACTGGCCTATCTTTGCATTTGCTCATGACCTTGGATCTGTGGAATCCGCAGTCTCGGTTCTATACTCT
ATTGGTCTGGCACAAACCGACGCAATCCAGTACGAAGGAAGTAGCAGTGGATCCACCATTCTACCTTCGCTGTGG
ACCAGCTATTTCAGCACGGGGCCGGAAGCTCTGGATTTCTTCCATAATGACTATGCTACATCCTCATCGCTCTCG
TCGGATCTTGATTCTCAGATAGCCCAGGATTCCGTTGCTGCAGCTGGCCAGGACTACCTGACAATCACTTCTCTC
ACGGTTCGTCAGGCTTTTGGTGCATGCCAGCTGTGCGGAACCCCGGACAACACCTACCTGTTCATGAAGGAAATC
TCGTCCGATGGAAACGTGAACACGGTCGACGTTATCTTCCCAGCGCACCCCATCTTCTTGTACACGAACCCTGAG
CTTCTTAACCTGCTGTTGAAGCCACTTTTCGAGATCCAGGAGTCTGGGAACTACCCCAACGCATACGCCATGCAC
GATGTAGGGAGCCACTATCCCAACGCTACTGGCCATCCTAAAGGCGATGATGAGGCGATGCCACTGGAAGAATGT
GGCAACATGGTTATCATGGCCTTGGCATATGCGCAGAAGGCAAGCGACACGGATTACCTGTCCCAGCATTATACC
TTGCTCAACCAGTGGACGGCGTACCTTGTGGAGGATGCAATCTACCCTGCCAACCAAATCTCGACAGATGACTTT
GCAGGCAGCTTGGCGAACCAGACCAACTTGGCCTTGAAGGGCATCATCGGTATCGAAGCCATGGCTGTGATTAGC
AACGAGACTGATCACTCTGCTAATGGAGCCAACTACACTGCCATTGCTCATAATTACATCGACCGATGGCAAATT
TTGGGCATCGCGCACAATGCCAACCCTCCTCATGCAACACTTGCTTATGGCTCCAACAACAGCCACGGTCTCCTA
TACAACCTCTATGCTGATCGCGAGCTGGGCCTAAACTTGGTCCCACAGTCCGTATACGACATGCAGAGTACATTC
TACCCCACTGTTCAACTAGAGTACGGAGTACCGCTCGACACTAGACACGAATACACAAAAGCCGATTGGGAAATG
TTTACTGCGGCCATTGCATCAACCAGTACTCGAGACATGTTCATGCAGCTTCTATCAAAGTGGATCAACGACACA
CCCACAAACTACGCAATGACTGATCTCTACGATGCAGTTGGCGGGGGCTACCCAACCAACGTCTTCATCGACCGT
CCCGTCGTGGGAGGTGCCTTTGCCTTGCTTCTGCTCAACCAAGGCAACTAA
Gene >Ani_SJS72_1|g4128.t1
ATGTATCAATTTTTCATAAGTTTATTGGTGACGGTGCTGGCCTCTTCGGCCAGGGCTACCTCTGTCTTCTCGCCT
GCCCGTCCTCCTGCGATACCGCTAGCCGTCAAATCGCCTTACCTGAGCACCTGGCTGTCTGCAGGCAGCGATGGA
GGCAACGGTGGCTATCTTGCGGGAGAATGGCCGATTTTCTGGTCGTAAGTAGTCCCGCGTATGGTATTTGATCCG
GAGCAAAACGGAGGCTGATTCTTGCTGTTGGATTAGTGGCCAGATTACTGGCTGGGCTGGAATGATTCGTGTTGA
TGGCAGTGCTTACACCTGGATGGGAATCCCTGGACCGGCGACTGTGAACCAAACTTCCTATGAGTACACCTCTAC
GAAAAGTATCTTCACCATGAATGTCGCCAACAAGGTGGAGATGAATATTACGTTCCTTTCGCCAATTACACCAAA
CGATTACAAACGCCAGTCGCTCGTTTTCTCCTATGTCGATGTGCAAGTTGAATCTCTCGATGGCCAGCCCCACGA
TGTGCAGCTGTATGCTGATATTTCGGCGGGTGAGTATTTGCCCTACTTGGCGGAGATGTCTCCGCGTGGCAATAG
GGTGGTCATTGTCTGACTTCACATAGAATGGGTGTCGGGAGACCGGACCACGACTGCAACATGGGATTACGGTAC
CACCGATAATGGTGTCGCCTATCACAAAGTCAGTCGCCAAACCCAGCTCGCTTTCTCCGAGGTCAGTGACCAAGG
AGAATGGGGAGACTGGTACTGGGCCACAGACAACAGTGAAAACCTGACCTACCAGTCTGGTATAGCCGATAATGT
CCGTGCAGCATTTGCTGCGAACGGAACGCTAGGCGACTCACAGGATTCTGACTATCGTGCCATATCTACCGACTG
GCCTATCTTTGCATTTGCTCATGACCTTGGATCTGTGGAATCCGCAGTCTCGGTTCTATACTCTATTGGTCTGGC
ACAAACCGACGCAATCCAGTACGAAGGAAGTAGCAGTGGATCCACCATTCTACCTTCGCTGTGGACCAGCTATTT
CAGCACGGGGCCGGAAGCTGTAAGTTTCCACGAGATGAATAACTCTAGGGCTATACTAATGCCGCTTTCAGCTGG
ATTTCTTCCATAATGACTATGCTACATCCTCATCGCTCTCGTCGGATCTTGATTCTCAGATAGCCCAGGATTCCG
TTGCTGCAGCTGGCCAGGACTACCTGACAATCACTTCTCTCACGGTTCGTCAGGCTTTTGGTGCATGCCAGCTGT
GCGGAACCCCGGACAACACCTACCTGTTCATGAAGGAAATCTCGTCCGATGGAAACGTGAACACGGTCGACGTTA
TCTTCCCAGCGCACCCCATCTTCTTGTACACGAACCCTGAGCTTCTTAACCTGCTGTTGAAGCCACTTTTCGAGA
TCCAGGAGTCTGGGAACTACCCCAACGCATACGCCATGCACGATGTAGGGAGCCACTATCCCAACGCTACTGGCC
ATCCTAAAGGCGATGATGAGGCGATGCCACTGGAAGAATGTGGCAACATGGTTATCATGGCCTTGGCATATGCGC
AGAAGGCAAGCGACACGGATTACCTGTCCCAGCATTATACCTTGCTCAACCAGTGGACGGCGTACCTTGTGGAGG
ATGCAATCTACCCTGCCAACCAAATCTCGACAGATGACTTTGCAGGCAGCTTGGCGTATGTGCAGACCCCCGCCT
CATGTGAGTCTTAGATGCTAACAACAGGCTTAGGAACCAGACCAACTTGGCCTTGAAGGGCATCATCGGTATCGA
AGCCATGGCTGTGATTAGCAACGAGACTGATCACTCTGCTAATGGAGCCAACTACACTGCCATTGCTCATAATTA
CATCGACCGATGGCAAATTTTGGGCATCGCGCACAATGCCAACCCTCCTCATGCAACACTTGCTTATGGCTCCAA
CAACAGCCACGGTATGTTTTCCTTGAATCCATACCAAAAATTATATGCTAACAGTCTTGCAGGTCTCCTATACAA
CCTCTATGCTGATCGCGAGCTGGGCCTAAACTTGGTCCCACAGTCCGTATACGACATGCAGAGTACATTCTACCC
CACTGTTCAACTAGAGTACGGAGTACCGCTCGACACTAGACACGAATACACAAAAGGTGAGCTTGACAAACCCAC
GGTGGTGATATACTCACTAATCTATTCTGCGCAGCCGATTGGGAAATGTTTACTGCGGCCATTGCATCAACCAGT
ACTCGAGACATGTTCATGCAGCTTCTATCAAAGTGGATCAACGACACACCCACAAACTACGCAATGACTGATCTC
TACGATGCAGTTGGCGGGGGGTGAGTACTAACAGGAAAATAATACTTGACTTCAACTAGCTAACCTATCCATTCC
CAGCTACCCAACCAACGTCTTCATCGACCGTCCCGTCGTGGGAGGTGCCTTTGCCTTGCTTCTGCTCAACCAAGG
CAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail