Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g412.t1
Gene name
Locationscaffold_002:259868..261843
Strand+
Gene length (bp)1975
Transcript length (bp)1797
Coding sequence length (bp)1797
Protein length (aa) 599

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10355 Ytp1 Protein of unknown function (Ytp1) 1.4E-116 288 577
PF10348 DUF2427 Domain of unknown function (DUF2427) 1.0E-32 56 156

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 69 91 22
3 104 121 17
4 136 158 22
5 283 302 19
6 312 334 22
7 368 390 22
8 395 414 19
9 486 505 19
10 520 542 22
11 554 576 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g412.t1
MWQRASRAALAAAFLLVSVANALPHGDDEAMDMDMGMDMSHSESTQESSTEANDDSPMSYFAYGKHGTAIAVHIG
LMILAWCFILPTAVMFSVARSRFALPSQFLFLVCNAVGLLIGIIYNSQTPDLYENNAHHKIGWIATWVMSAQVIM
SLIFAYAGRGESESTSYERAAFLPVSTDEMESPQMYSGGIRHSYRWSRDSGQGTERNSSSLHSRPGSPSCASPSD
EYDGFEKPEDPLPEPSSQPRGWFRIPFADRFLASRVPRLVSTRALRIISTIYAVIDRIILPFGFVAIATGGVTYG
GLMRGKEVFNGLAHFIKGGIFFWYGLLTLGRMLGCWADLGWAWNVKPSSPIVGKCKAKIPTGEFTESFVIFLYGV
TNVFLEHLTGWGGAWTATDLEHVSISIMFFGGGLCGMLFESKRVKGWLNSTVLQYPSHMSAHTSADTAWQLPDTQ
GVSLNPMPALVILLLGMMMGSHHQDSMVSTMVHKQWGNLLVGFALARGMTYVIMYLKPPTSYLPSRPPTEIVAAF
CLISGGLVFMLSTRSVIQTLEYYDLDAMFVFTVTMGLTAFIMSCEILAIALKAWAVKRESRPALPPFQFPASA*
Coding >Ani_SJS72_1|g412.t1
ATGTGGCAGCGAGCTTCCCGTGCCGCGCTTGCGGCAGCTTTCCTTCTAGTCTCCGTTGCGAATGCGCTTCCCCAC
GGAGACGACGAAGCGATGGACATGGACATGGGTATGGATATGAGCCACAGCGAGTCCACCCAGGAATCGTCCACA
GAGGCAAATGACGACTCCCCCATGAGCTACTTCGCGTATGGGAAACACGGCACCGCGATTGCGGTTCACATCGGT
CTCATGATTCTCGCCTGGTGCTTCATTCTGCCGACAGCGGTCATGTTCAGCGTCGCACGGTCACGTTTCGCATTG
CCGTCGCAATTCCTTTTCTTGGTATGCAACGCGGTGGGATTGCTTATTGGAATCATCTACAACAGCCAGACCCCC
GATCTGTATGAGAACAACGCTCATCACAAGATTGGCTGGATCGCAACCTGGGTCATGAGCGCGCAGGTCATCATG
TCGTTGATCTTTGCCTATGCTGGCAGAGGCGAGTCGGAGTCGACTTCGTATGAACGGGCAGCGTTCCTTCCCGTT
TCTACCGATGAGATGGAGAGCCCCCAGATGTACTCTGGTGGTATTCGCCATTCGTACCGCTGGTCGCGCGACAGT
GGACAGGGCACGGAGAGAAATTCCTCTTCCCTCCACAGTCGTCCTGGGTCGCCATCTTGTGCGTCGCCTTCGGAT
GAGTATGACGGTTTCGAAAAGCCCGAGGATCCGCTCCCCGAACCCTCGTCCCAACCGCGCGGGTGGTTCCGCATC
CCCTTCGCCGACCGATTCCTTGCCAGCCGTGTACCTCGTCTGGTCTCCACCAGAGCGCTTCGCATTATCTCGACC
ATCTATGCTGTTATCGACAGAATCATCTTGCCGTTTGGCTTCGTTGCTATTGCGACAGGTGGTGTGACTTATGGT
GGTCTCATGAGAGGCAAGGAGGTCTTCAACGGCCTCGCCCACTTCATCAAAGGAGGTATCTTTTTCTGGTATGGT
CTTCTGACTCTGGGACGCATGCTTGGCTGCTGGGCCGACCTGGGTTGGGCCTGGAACGTGAAGCCATCCAGTCCC
ATTGTCGGTAAATGTAAGGCGAAGATCCCCACGGGTGAATTCACTGAATCATTCGTGATCTTCCTCTACGGCGTT
ACCAACGTCTTCTTGGAGCACCTCACCGGTTGGGGTGGCGCGTGGACTGCCACCGACCTTGAGCATGTGTCCATC
TCCATCATGTTCTTCGGTGGTGGTCTCTGTGGTATGCTCTTCGAGTCGAAGCGCGTCAAAGGCTGGTTGAACAGT
ACAGTTCTTCAATACCCCTCCCACATGAGCGCACACACCTCAGCAGATACCGCATGGCAGCTCCCTGACACCCAG
GGTGTATCACTGAACCCTATGCCTGCGCTGGTCATCCTTCTGTTGGGTATGATGATGGGTTCGCACCACCAGGAT
AGTATGGTATCGACCATGGTGCACAAGCAGTGGGGTAACCTCCTTGTCGGCTTTGCACTGGCTCGTGGCATGACC
TATGTCATCATGTACCTCAAGCCTCCGACCTCCTACCTTCCATCTCGCCCGCCAACCGAGATCGTCGCTGCTTTC
TGCTTGATTTCGGGTGGTTTGGTCTTCATGCTTAGTACCCGGAGCGTGATCCAAACCCTGGAGTACTATGACCTC
GACGCGATGTTTGTGTTCACAGTCACTATGGGACTGACCGCCTTCATCATGTCGTGCGAAATTCTCGCCATTGCC
TTGAAGGCCTGGGCGGTGAAGCGGGAGTCGCGCCCTGCGCTGCCGCCTTTCCAATTCCCGGCCTCCGCCTGA
Transcript >Ani_SJS72_1|g412.t1
ATGTGGCAGCGAGCTTCCCGTGCCGCGCTTGCGGCAGCTTTCCTTCTAGTCTCCGTTGCGAATGCGCTTCCCCAC
GGAGACGACGAAGCGATGGACATGGACATGGGTATGGATATGAGCCACAGCGAGTCCACCCAGGAATCGTCCACA
GAGGCAAATGACGACTCCCCCATGAGCTACTTCGCGTATGGGAAACACGGCACCGCGATTGCGGTTCACATCGGT
CTCATGATTCTCGCCTGGTGCTTCATTCTGCCGACAGCGGTCATGTTCAGCGTCGCACGGTCACGTTTCGCATTG
CCGTCGCAATTCCTTTTCTTGGTATGCAACGCGGTGGGATTGCTTATTGGAATCATCTACAACAGCCAGACCCCC
GATCTGTATGAGAACAACGCTCATCACAAGATTGGCTGGATCGCAACCTGGGTCATGAGCGCGCAGGTCATCATG
TCGTTGATCTTTGCCTATGCTGGCAGAGGCGAGTCGGAGTCGACTTCGTATGAACGGGCAGCGTTCCTTCCCGTT
TCTACCGATGAGATGGAGAGCCCCCAGATGTACTCTGGTGGTATTCGCCATTCGTACCGCTGGTCGCGCGACAGT
GGACAGGGCACGGAGAGAAATTCCTCTTCCCTCCACAGTCGTCCTGGGTCGCCATCTTGTGCGTCGCCTTCGGAT
GAGTATGACGGTTTCGAAAAGCCCGAGGATCCGCTCCCCGAACCCTCGTCCCAACCGCGCGGGTGGTTCCGCATC
CCCTTCGCCGACCGATTCCTTGCCAGCCGTGTACCTCGTCTGGTCTCCACCAGAGCGCTTCGCATTATCTCGACC
ATCTATGCTGTTATCGACAGAATCATCTTGCCGTTTGGCTTCGTTGCTATTGCGACAGGTGGTGTGACTTATGGT
GGTCTCATGAGAGGCAAGGAGGTCTTCAACGGCCTCGCCCACTTCATCAAAGGAGGTATCTTTTTCTGGTATGGT
CTTCTGACTCTGGGACGCATGCTTGGCTGCTGGGCCGACCTGGGTTGGGCCTGGAACGTGAAGCCATCCAGTCCC
ATTGTCGGTAAATGTAAGGCGAAGATCCCCACGGGTGAATTCACTGAATCATTCGTGATCTTCCTCTACGGCGTT
ACCAACGTCTTCTTGGAGCACCTCACCGGTTGGGGTGGCGCGTGGACTGCCACCGACCTTGAGCATGTGTCCATC
TCCATCATGTTCTTCGGTGGTGGTCTCTGTGGTATGCTCTTCGAGTCGAAGCGCGTCAAAGGCTGGTTGAACAGT
ACAGTTCTTCAATACCCCTCCCACATGAGCGCACACACCTCAGCAGATACCGCATGGCAGCTCCCTGACACCCAG
GGTGTATCACTGAACCCTATGCCTGCGCTGGTCATCCTTCTGTTGGGTATGATGATGGGTTCGCACCACCAGGAT
AGTATGGTATCGACCATGGTGCACAAGCAGTGGGGTAACCTCCTTGTCGGCTTTGCACTGGCTCGTGGCATGACC
TATGTCATCATGTACCTCAAGCCTCCGACCTCCTACCTTCCATCTCGCCCGCCAACCGAGATCGTCGCTGCTTTC
TGCTTGATTTCGGGTGGTTTGGTCTTCATGCTTAGTACCCGGAGCGTGATCCAAACCCTGGAGTACTATGACCTC
GACGCGATGTTTGTGTTCACAGTCACTATGGGACTGACCGCCTTCATCATGTCGTGCGAAATTCTCGCCATTGCC
TTGAAGGCCTGGGCGGTGAAGCGGGAGTCGCGCCCTGCGCTGCCGCCTTTCCAATTCCCGGCCTCCGCCTGA
Gene >Ani_SJS72_1|g412.t1
ATGTGGCAGCGAGCTTCCCGTGCCGCGCTTGCGGCAGCTTTCCTTCTAGTCTCCGTTGCGAATGCGCTTCCCCAC
GGAGACGACGAAGCGATGGACATGGACATGGGTATGGATATGAGCCACAGCGAGTCCACCCAGGAATCGTCCACA
GAGGCAAATGACGACTCCCCCATGAGCTACTTCGCGTATGGGAAACACGGCACCGCGATTGCGGTTCACATCGGT
CTCATGATTCTCGCCTGGTGCTTCATTCTGCCGACAGGTATAGCTCCATTTTATCTAACCCTCACAAAGACACAG
AAAACTAACACTTTGCAATAACAGCGGTCATGTTCAGCGTCGCACGGTCACGTTTCGCATTGCCGTCGCAATTCC
TTTTCTTGGTATGCAACGCGGTGGGATTGCTTATTGGAATCATCTACAACAGCCAGACCCCCGATCTGTATGAGA
ACAACGCTCATCACAAGATTGGCTGGATCGCAACCTGGGTCATGAGCGCGCAGGTCATCATGTCGTTGATCTTTG
CCTATGCTGGCAGAGGCGAGTCGGAGTCGACTTCGTATGAACGGGCAGCGTTCCTTCCCGTTTCTACCGATGAGA
TGGAGAGCCCCCAGATGTACTCTGGTGGTATTCGCCATTCGTACCGCTGGTCGCGCGACAGTGGACAGGGCACGG
AGAGAAATTCCTCTTCCCTCCACAGTCGTCCTGGGTCGCCATCTTGTGCGTCGCCTTCGGATGAGTATGACGGTT
TCGAAAAGCCCGAGGATCCGCTCCCCGAACCCTCGTCCCAACCGCGCGGGTGGTTCCGCATCCCCTTCGCCGACC
GATTCCTTGCCAGCCGTGTACCTCGTCTGGTCTCCACCAGAGCGCTTCGCATTATCTCGACCATCTATGCTGTTA
TCGACAGAATCATCTTGCCGTTTGGCTTCGTTGCTATTGCGACAGGTGGTGTGACTTATGGTGGTCTCATGGTAA
GTTTCTAGGCAATAGACCGTTCTAATGAATTCTGCTAACGCGCATTGGCAGAGAGGCAAGGAGGTCTTCAACGGC
CTCGCCCACTTCATCAAAGGAGGTATCTTTTTCTGGTATGGTCTTCTGACTCTGGGACGCATGCTTGGCTGCTGG
GCCGACCTGGGTTGGGCCTGGAACGTGAAGCCATCCAGTCCCATTGTCGGTAAATGTAAGGCGAAGATCCCCACG
GGTGAATTCACTGAATCATTCGTGATCTTCCTCTACGGCGTTACCAACGTCTTCTTGGAGCACCTCACCGGTTGG
GGTGGCGCGTGGACTGCCACCGACCTTGAGCATGTGTCCATCTCCATCATGTTCTTCGGTGGTGGTCTCTGTGGT
ATGCTCTTCGAGTCGAAGCGCGTCAAAGGCTGGTTGAACAGTACAGTTCTTCAATACCCCTCCCACATGAGCGCA
CACACCTCAGCAGATACCGCATGGCAGCTCCCTGACACCCAGGGTGTATCACTGAACCCTATGCCTGCGCTGGTC
ATCCTTCTGTTGGGTATGATGATGGGTTCGCACCACCAGGATAGTATGGTATCGACCATGGTGCACAAGCAGTGG
GGTAACCTCCTTGTCGGCTTTGCACTGGCTCGTGGCATGACCTATGTCATCATGTACCTCAAGCCTCCGACCTCC
TACCTTCCATCTCGCCCGCCAACCGAGATCGTCGCTGCTTTCTGCTTGATTTCGGGTGGTTTGGTCTTCATGCTT
AGTGTAAGTCCAGCAAAGGAACCGCGATTCATCCACAGGACATCTTAGCTGACTCATAGGACAGACCCGGAGCGT
GATCCAAACCCTGGAGTACTATGACCTCGACGCGATGTTTGTGTTCACAGTCACTATGGGACTGACCGCCTTCAT
CATGTCGTGCGAAATTCTCGCCATTGCCTTGAAGGCCTGGGCGGTGAAGCGGGAGTCGCGCCCTGCGCTGCCGCC
TTTCCAATTCCCGGCCTCCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail