Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g4053.t1
Gene name
Locationscaffold_024:66598..68841
Strand+
Gene length (bp)2243
Transcript length (bp)2184
Coding sequence length (bp)2184
Protein length (aa) 728

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 3.2E-142 169 623
PF14558 TRP_N ML-like domain 2.5E-41 26 164

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 352 374 22
2 394 416 22
3 431 453 22
4 490 512 22
5 522 539 17
6 552 569 17
7 584 606 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g4053.t1
MRLIPSFSTLTALGLLATRALAADTLSTNGLTTCMSDSAIQVDKLSVTYTRSTREIVFDVSGTNGVEQNVTAILT
IYAYGSQLYSETFDPCSSKYYVEQLCPVAAGSFSATGTQTLPESIASEIPSIAFAIPDLDGQVKLQLLSKTDNDE
LACIQSELTNGNTMQIAGVSYAAAGVAGAALAVSGLSALGAVGHPGAVSSSPSFGDVVSWFHTMATNGMLSVSYP
TVYRSFSKNFAFSTGLIPWGQMQESIDNFRKSTGGNLTDNSYQYLLNATLVYSDGTNSSSKSKRGLDLVTGMANL
AAREVSTSYSSNTTSSSNSTSDDSSSFEHFVSGIEAYAEQLTIPQANTFMTVLLIFAILIAAIAVGILLLKVILE
VWALYGSFPDKLTNFRKDYWGLLGRTITNLILLLYSVWVIWCVYQLSSGDSWAAKLLAAVALTVFTAVLLYFGLK
IMFVARKYKKTEGDASHLYDNDETWRKYSLFYDNYKKDYWWAFVPAIVYMFAKGCVIAAGDGHGLAQSAGQLIVE
ALMLTLLLWNRPYVAKSSQWINISVQVVRVLSIACVLIFVDELGLSETTKTVTGIVLIAIQSGLSGILAILIATN
AIILCIRENPHAKRKREANKMNRDLDDLTPLDARESLLMEHPPRKDYAEMSKFNFTGPYEPYRDQHDSKSRHSPT
GSTDRLVDSSYPLEDVNGRSISRESRRSHDSHGSHENPEKHHATTPGYGFAY*
Coding >Ani_SJS72_1|g4053.t1
ATGCGGCTCATTCCTTCTTTTTCGACCCTTACGGCGCTGGGTCTCCTGGCCACTCGAGCCCTCGCTGCCGATACC
CTCAGCACCAATGGTCTGACAACTTGTATGTCAGACTCTGCTATCCAAGTCGACAAACTATCCGTCACCTATACC
CGTTCTACTAGAGAAATCGTCTTCGATGTTTCCGGCACCAATGGGGTAGAACAGAATGTCACGGCAATCTTGACC
ATCTATGCCTACGGCAGTCAACTCTACTCCGAAACGTTCGACCCGTGCAGCAGCAAATACTACGTGGAGCAACTC
TGTCCCGTGGCTGCCGGTAGCTTCTCCGCGACTGGCACGCAGACCCTACCTGAATCGATCGCTAGTGAAATCCCC
TCCATCGCCTTCGCCATCCCAGACTTGGATGGCCAAGTGAAGCTTCAATTGCTGTCCAAGACCGACAATGACGAG
CTGGCATGCATCCAATCGGAACTGACCAACGGCAATACTATGCAGATCGCTGGTGTATCCTATGCTGCTGCTGGT
GTGGCTGGTGCGGCATTGGCCGTGAGCGGGCTGTCAGCTCTGGGTGCTGTTGGCCACCCTGGTGCCGTCTCATCT
AGTCCCAGCTTTGGTGATGTCGTGAGTTGGTTTCACACTATGGCCACTAATGGAATGCTCAGTGTCAGCTACCCG
ACGGTGTACCGCAGCTTTTCGAAGAACTTTGCCTTCAGCACGGGTTTGATTCCTTGGGGTCAAATGCAGGAGTCC
ATCGATAACTTCCGGAAGTCGACCGGCGGCAATCTCACCGACAACAGCTACCAGTATCTTCTCAATGCCACGCTC
GTGTACTCTGACGGCACGAATTCTAGCTCAAAGTCGAAGCGAGGACTGGATCTGGTCACAGGCATGGCTAACCTA
GCTGCGCGCGAGGTCTCGACTTCGTATAGCAGCAATACTACTTCGTCGTCTAACAGCACCAGTGACGACAGCAGT
AGTTTCGAACATTTCGTCTCCGGAATTGAGGCCTATGCCGAACAGTTGACCATCCCTCAAGCCAACACCTTCATG
ACCGTTCTGCTCATTTTCGCTATCCTAATTGCCGCTATTGCCGTTGGCATCTTGTTGCTCAAGGTCATCCTCGAA
GTTTGGGCGCTCTACGGCTCTTTCCCGGACAAACTCACCAACTTCCGCAAAGACTACTGGGGTCTCCTGGGTCGC
ACAATTACCAACTTGATTCTGCTGCTGTACAGCGTTTGGGTGATTTGGTGTGTCTATCAGCTCAGCAGTGGGGAT
TCGTGGGCGGCGAAGCTCTTGGCTGCTGTGGCGCTTACAGTTTTCACGGCTGTGTTATTGTACTTTGGTCTCAAG
ATCATGTTCGTGGCTCGGAAGTACAAGAAGACTGAAGGTGATGCGTCCCATTTGTACGACAACGATGAAACCTGG
CGCAAGTACAGTCTTTTCTACGACAACTACAAAAAGGACTACTGGTGGGCATTCGTCCCTGCCATTGTATACATG
TTTGCCAAGGGTTGCGTCATTGCTGCTGGAGATGGTCATGGGCTTGCCCAAAGCGCTGGCCAACTCATCGTGGAG
GCTCTCATGCTCACCCTTTTGCTGTGGAACCGTCCGTACGTTGCCAAGTCTAGCCAGTGGATCAACATTTCAGTC
CAGGTGGTTCGTGTCTTGTCAATCGCGTGTGTGTTGATCTTCGTCGACGAGCTGGGGCTCTCGGAGACGACCAAA
ACTGTCACCGGCATTGTCCTCATTGCTATTCAGTCGGGACTGAGTGGTATCTTGGCCATTCTTATTGCCACCAAC
GCCATTATCCTCTGCATTCGCGAGAACCCTCATGCTAAACGGAAGAGGGAAGCTAACAAAATGAATCGTGATCTC
GATGATTTGACCCCTCTTGACGCCCGTGAATCTCTGCTCATGGAGCATCCTCCTCGCAAGGATTACGCTGAAATG
AGCAAGTTCAACTTTACCGGTCCTTACGAACCATACCGGGATCAACATGATTCGAAATCGCGACACAGCCCTACA
GGTAGCACGGATCGGCTGGTTGATTCAAGCTACCCTCTTGAAGACGTCAATGGTCGAAGTATAAGTCGAGAAAGC
CGCCGAAGCCATGACAGTCATGGCAGCCATGAAAACCCTGAAAAGCACCATGCCACGACCCCGGGTTATGGGTTC
GCTTACTGA
Transcript >Ani_SJS72_1|g4053.t1
ATGCGGCTCATTCCTTCTTTTTCGACCCTTACGGCGCTGGGTCTCCTGGCCACTCGAGCCCTCGCTGCCGATACC
CTCAGCACCAATGGTCTGACAACTTGTATGTCAGACTCTGCTATCCAAGTCGACAAACTATCCGTCACCTATACC
CGTTCTACTAGAGAAATCGTCTTCGATGTTTCCGGCACCAATGGGGTAGAACAGAATGTCACGGCAATCTTGACC
ATCTATGCCTACGGCAGTCAACTCTACTCCGAAACGTTCGACCCGTGCAGCAGCAAATACTACGTGGAGCAACTC
TGTCCCGTGGCTGCCGGTAGCTTCTCCGCGACTGGCACGCAGACCCTACCTGAATCGATCGCTAGTGAAATCCCC
TCCATCGCCTTCGCCATCCCAGACTTGGATGGCCAAGTGAAGCTTCAATTGCTGTCCAAGACCGACAATGACGAG
CTGGCATGCATCCAATCGGAACTGACCAACGGCAATACTATGCAGATCGCTGGTGTATCCTATGCTGCTGCTGGT
GTGGCTGGTGCGGCATTGGCCGTGAGCGGGCTGTCAGCTCTGGGTGCTGTTGGCCACCCTGGTGCCGTCTCATCT
AGTCCCAGCTTTGGTGATGTCGTGAGTTGGTTTCACACTATGGCCACTAATGGAATGCTCAGTGTCAGCTACCCG
ACGGTGTACCGCAGCTTTTCGAAGAACTTTGCCTTCAGCACGGGTTTGATTCCTTGGGGTCAAATGCAGGAGTCC
ATCGATAACTTCCGGAAGTCGACCGGCGGCAATCTCACCGACAACAGCTACCAGTATCTTCTCAATGCCACGCTC
GTGTACTCTGACGGCACGAATTCTAGCTCAAAGTCGAAGCGAGGACTGGATCTGGTCACAGGCATGGCTAACCTA
GCTGCGCGCGAGGTCTCGACTTCGTATAGCAGCAATACTACTTCGTCGTCTAACAGCACCAGTGACGACAGCAGT
AGTTTCGAACATTTCGTCTCCGGAATTGAGGCCTATGCCGAACAGTTGACCATCCCTCAAGCCAACACCTTCATG
ACCGTTCTGCTCATTTTCGCTATCCTAATTGCCGCTATTGCCGTTGGCATCTTGTTGCTCAAGGTCATCCTCGAA
GTTTGGGCGCTCTACGGCTCTTTCCCGGACAAACTCACCAACTTCCGCAAAGACTACTGGGGTCTCCTGGGTCGC
ACAATTACCAACTTGATTCTGCTGCTGTACAGCGTTTGGGTGATTTGGTGTGTCTATCAGCTCAGCAGTGGGGAT
TCGTGGGCGGCGAAGCTCTTGGCTGCTGTGGCGCTTACAGTTTTCACGGCTGTGTTATTGTACTTTGGTCTCAAG
ATCATGTTCGTGGCTCGGAAGTACAAGAAGACTGAAGGTGATGCGTCCCATTTGTACGACAACGATGAAACCTGG
CGCAAGTACAGTCTTTTCTACGACAACTACAAAAAGGACTACTGGTGGGCATTCGTCCCTGCCATTGTATACATG
TTTGCCAAGGGTTGCGTCATTGCTGCTGGAGATGGTCATGGGCTTGCCCAAAGCGCTGGCCAACTCATCGTGGAG
GCTCTCATGCTCACCCTTTTGCTGTGGAACCGTCCGTACGTTGCCAAGTCTAGCCAGTGGATCAACATTTCAGTC
CAGGTGGTTCGTGTCTTGTCAATCGCGTGTGTGTTGATCTTCGTCGACGAGCTGGGGCTCTCGGAGACGACCAAA
ACTGTCACCGGCATTGTCCTCATTGCTATTCAGTCGGGACTGAGTGGTATCTTGGCCATTCTTATTGCCACCAAC
GCCATTATCCTCTGCATTCGCGAGAACCCTCATGCTAAACGGAAGAGGGAAGCTAACAAAATGAATCGTGATCTC
GATGATTTGACCCCTCTTGACGCCCGTGAATCTCTGCTCATGGAGCATCCTCCTCGCAAGGATTACGCTGAAATG
AGCAAGTTCAACTTTACCGGTCCTTACGAACCATACCGGGATCAACATGATTCGAAATCGCGACACAGCCCTACA
GGTAGCACGGATCGGCTGGTTGATTCAAGCTACCCTCTTGAAGACGTCAATGGTCGAAGTATAAGTCGAGAAAGC
CGCCGAAGCCATGACAGTCATGGCAGCCATGAAAACCCTGAAAAGCACCATGCCACGACCCCGGGTTATGGGTTC
GCTTACTGA
Gene >Ani_SJS72_1|g4053.t1
ATGCGGCTCATTCCTTCTTTTTCGACCCTTACGGCGCTGGGTCTCCTGGCCACTCGAGCCCTCGCTGCCGATACC
CTCAGCACCAATGGTCTGACAACTTGTATGTCAGACTCTGCTATCCAAGTCGACAAACTATCCGTCACCTATACC
CGTTCTACTAGAGAAATCGTCTTCGATGTTTCCGGCACCAATGGGGTAGAACAGAATGTCACGGCAATCTTGACC
ATCTATGCCTACGGCAGTCAACTCTACTCCGAAACGTTCGACCCGTGCAGCAGCAAATACTACGTGGAGCAACTC
TGTCCCGTGGCTGCCGGTAGCTTCTCCGCGACTGGCACGCAGACCCTACCTGAATCGATCGCTAGTGAAATCCCC
TCCATCGCCTTCGCCATCCCAGACTTGGATGGCCAAGTGAAGCTTCAATTGCTGTCCAAGACCGACAATGACGAG
CTGGCATGCATCCAATCGGAACTGACCAACGGCAATACTATGCAGATCGCTGGTGTATCCTATGCTGCTGCTGGT
GTGGCTGGTGCGGCATTGGCCGTGAGCGGGCTGTCAGCTCTGGGTGCTGTTGGCCACCCTGGTGCCGTCTCATCT
AGTCCCAGCTTTGGTGATGTCGTGAGTTGGTTTCACACTATGGCCACTAATGGAATGCTCAGTGTCAGCTACCCG
ACGGTGTACCGCAGCTTTTCGAAGAACTTTGCCTTCAGCACGGGTTTGATTCCTTGGGGTCAAATGCAGGAGTCC
ATCGATAACTTCCGGAAGTCGACCGGCGGCAATCTCACCGACAACAGCTACCAGTATCTTCTCAATGCCACGCTC
GTGTACTCTGACGGCACGAATTCTAGCTCAAAGTCGAAGCGAGGACTGGATCTGGTCACAGGCATGGCTAACCTA
GCTGCGCGCGAGGTCTCGACTTCGTATAGCAGCAATACTACTTCGTCGTCTAACAGCACCAGTGACGACAGCAGT
AGTTTCGAACATTTCGTCTCCGGAATTGAGGCCTATGCCGAACAGTTGACCATCCCTCAAGCCAACACCTTCATG
ACCGTTCTGCTCATTTTCGCTATCCTAATTGCCGCTATTGCCGTTGGCATCTTGTTGCTCAAGGTCATCCTCGAA
GTTTGGGCGCTCTACGGCTCTTTCCCGGACAAACTCACCAACTTCCGCAAAGACTACTGGGGTCTCCTGGGTCGC
ACAATTACCAACTTGATTCTGCTGCTGTACAGCGTTTGGGTGATTTGGTGTGTCTATCAGCTCAGCAGTGGGGAT
TCGTGGGCGGCGAAGCTCTTGGCTGCTGTGGCGCTTACAGTTTTCACGGCTGTGTTATTGTACTTTGGTCTCAAG
ATCATGTTCGTGGCTCGGAAGTACAAGAAGACTGAAGGTGATGCGTCCCATTTGTACGACAACGATGAAACCTGG
CGCAAGTACAGTCTTTTCTACGACAACTACAAAAAGGACTACTGGTGGGCATTCGTCCCTGCCATTGTATACATG
TTTGCCAAGGGTTGCGTCATTGCTGCTGGAGATGGTCATGGGCTTGCCCAAAGCGCTGGCCAACTCATCGTGGAG
GCTCTCATGCTCACCCTTTTGCTGTGGAACCGTCCGTACGTTGCCAAGTCTAGCCAGTGGATCAACATTTCAGTC
CAGGTGGTTCGTGTCTTGTCAATCGCGTGTGTGTTGATCTTCGTCGACGAGCTGGGGCTCTCGGAGACGACCAAA
ACTGTCACCGGCATTGTCCTCATTGCTATTCAGTCGGGACTGAGTGGTATCTTGGCCATTCTTATTGCCACCAAC
GCCATTATCCTCTGCATTCGCGAGAACCCTCATGCTAAACGGAAGAGGGAAGCTAGTAAGTGAATTGGCCACTGT
GTTCGACACTCTTTGGGTTGCTGACTAGTGTGTTACCAGACAAAATGAATCGTGATCTCGATGATTTGACCCCTC
TTGACGCCCGTGAATCTCTGCTCATGGAGCATCCTCCTCGCAAGGATTACGCTGAAATGAGCAAGTTCAACTTTA
CCGGTCCTTACGAACCATACCGGGATCAACATGATTCGAAATCGCGACACAGCCCTACAGGTAGCACGGATCGGC
TGGTTGATTCAAGCTACCCTCTTGAAGACGTCAATGGTCGAAGTATAAGTCGAGAAAGCCGCCGAAGCCATGACA
GTCATGGCAGCCATGAAAACCCTGAAAAGCACCATGCCACGACCCCGGGTTATGGGTTCGCTTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail