Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g4045.t1
Gene name
Locationscaffold_024:45892..47704
Strand+
Gene length (bp)1812
Transcript length (bp)1548
Coding sequence length (bp)1548
Protein length (aa) 516

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 2.4E-29 27 126
PF00085 Thioredoxin Thioredoxin 5.3E-24 362 467
PF13848 Thioredoxin_6 Thioredoxin-like domain 3.6E-07 60 164
PF13848 Thioredoxin_6 Thioredoxin-like domain 3.9E-37 159 338
PF01216 Calsequestrin Calsequestrin 5.2E-12 65 344

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0046872 metal ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g4045.t1
MRSFAPWLVSLLGASAVVAAADTESDVISLDQDTFESFMNEHGLVLAEFFAPWCGHCKALAPKYEEAATELKAKN
IPLVKVDCTAEEDLCRSQGVEGYPTLKIFRGVDSSKPYQGARQTESIVSYMIKQSLPAVSSVNEENLEEIKTMDK
IVVIGYIPSDDQETYQAFEKYAESQRDNYLFAATDDAAIAKSEGVEQPSIVLYKDFDEKKAVYDGEIEQEAIHSW
VKSASTPLVGEIGPETYSGYIGAGVPLAYIFAETKEEREKYTEDFKPIAQKHKGAINIATIDAKMFGAHAGNLNL
DSQKFPAFAIQDPAKNAKYPYDQAKELNADEVEKFIQDVLDGKVEPSIKSEPVPESQEGPVTVVVAHSYKDLVID
NDKDVLLEFYAPWCGHCKALAPKYDELAALYADHPDLAAKVTIAKIDATANDVPDPITGFPTLRLYPAGAKDSPI
EYSGSRTVEDLANFVKENGKHNVDALNVASEETQEGGDVTEAAPSATEAETPAATDDEKAEHDEL*
Coding >Ani_SJS72_1|g4045.t1
ATGCGCTCCTTCGCGCCTTGGCTCGTTAGCCTTCTCGGAGCATCCGCGGTGGTTGCGGCTGCTGATACCGAGTCT
GATGTTATTTCACTGGATCAGGACACATTTGAGAGCTTCATGAACGAGCACGGTCTCGTGCTTGCCGAATTCTTT
GCTCCTTGGTGTGGCCACTGTAAAGCCCTCGCACCAAAGTATGAGGAAGCAGCTACGGAGCTCAAGGCGAAGAAT
ATCCCTCTGGTGAAGGTTGACTGCACCGCCGAGGAGGATCTCTGCCGGAGTCAGGGCGTTGAAGGCTACCCTACC
CTCAAGATCTTTCGGGGTGTTGACTCTAGCAAGCCTTACCAGGGCGCTAGGCAAACAGAATCAATCGTTTCCTAC
ATGATTAAGCAGTCACTTCCTGCAGTATCCTCCGTGAACGAGGAGAATTTAGAAGAGATCAAGACCATGGACAAG
ATTGTCGTGATCGGTTATATCCCGTCCGACGACCAGGAAACTTATCAAGCATTCGAAAAATATGCTGAGTCTCAG
CGGGATAACTACCTCTTTGCTGCCACGGACGATGCCGCCATTGCGAAATCGGAAGGTGTCGAGCAGCCCTCCATC
GTGCTCTATAAGGACTTCGATGAGAAGAAGGCTGTTTACGATGGCGAGATCGAACAGGAGGCTATTCACAGCTGG
GTGAAATCCGCTAGTACTCCCCTTGTGGGCGAGATTGGCCCTGAGACCTACTCTGGCTATATTGGGGCTGGAGTC
CCATTGGCCTATATCTTTGCCGAGACCAAGGAGGAGCGCGAAAAGTACACCGAAGACTTCAAGCCTATTGCCCAG
AAGCACAAGGGTGCTATCAACATTGCTACTATTGACGCCAAGATGTTCGGTGCCCACGCTGGAAACCTCAACCTA
GACTCTCAGAAGTTCCCGGCATTCGCCATCCAGGATCCCGCAAAGAACGCCAAATACCCCTATGACCAGGCCAAG
GAATTGAATGCCGACGAGGTTGAAAAGTTCATCCAGGATGTTCTGGATGGGAAGGTCGAGCCTAGCATCAAGTCG
GAACCTGTTCCCGAATCTCAGGAGGGCCCCGTCACGGTTGTAGTGGCCCATTCCTACAAGGATCTCGTCATTGAC
AATGACAAGGATGTCTTGCTCGAATTCTACGCACCTTGGTGTGGACACTGCAAAGCTCTTGCTCCGAAGTACGAT
GAGCTCGCAGCTCTCTATGCTGACCACCCCGATTTGGCGGCTAAGGTCACCATCGCTAAGATCGATGCGACGGCC
AACGATGTTCCGGACCCGATTACCGGATTCCCTACCCTCAGACTCTACCCGGCCGGTGCCAAGGACTCCCCCATT
GAGTACTCTGGCTCGCGCACTGTCGAGGATCTTGCCAACTTTGTGAAGGAGAATGGCAAACACAACGTTGACGCC
CTCAATGTCGCTTCCGAGGAAACACAGGAGGGTGGTGATGTGACTGAGGCTGCTCCCTCCGCTACGGAGGCCGAG
ACCCCGGCTGCCACAGATGACGAGAAGGCAGAACATGACGAACTGTAA
Transcript >Ani_SJS72_1|g4045.t1
ATGCGCTCCTTCGCGCCTTGGCTCGTTAGCCTTCTCGGAGCATCCGCGGTGGTTGCGGCTGCTGATACCGAGTCT
GATGTTATTTCACTGGATCAGGACACATTTGAGAGCTTCATGAACGAGCACGGTCTCGTGCTTGCCGAATTCTTT
GCTCCTTGGTGTGGCCACTGTAAAGCCCTCGCACCAAAGTATGAGGAAGCAGCTACGGAGCTCAAGGCGAAGAAT
ATCCCTCTGGTGAAGGTTGACTGCACCGCCGAGGAGGATCTCTGCCGGAGTCAGGGCGTTGAAGGCTACCCTACC
CTCAAGATCTTTCGGGGTGTTGACTCTAGCAAGCCTTACCAGGGCGCTAGGCAAACAGAATCAATCGTTTCCTAC
ATGATTAAGCAGTCACTTCCTGCAGTATCCTCCGTGAACGAGGAGAATTTAGAAGAGATCAAGACCATGGACAAG
ATTGTCGTGATCGGTTATATCCCGTCCGACGACCAGGAAACTTATCAAGCATTCGAAAAATATGCTGAGTCTCAG
CGGGATAACTACCTCTTTGCTGCCACGGACGATGCCGCCATTGCGAAATCGGAAGGTGTCGAGCAGCCCTCCATC
GTGCTCTATAAGGACTTCGATGAGAAGAAGGCTGTTTACGATGGCGAGATCGAACAGGAGGCTATTCACAGCTGG
GTGAAATCCGCTAGTACTCCCCTTGTGGGCGAGATTGGCCCTGAGACCTACTCTGGCTATATTGGGGCTGGAGTC
CCATTGGCCTATATCTTTGCCGAGACCAAGGAGGAGCGCGAAAAGTACACCGAAGACTTCAAGCCTATTGCCCAG
AAGCACAAGGGTGCTATCAACATTGCTACTATTGACGCCAAGATGTTCGGTGCCCACGCTGGAAACCTCAACCTA
GACTCTCAGAAGTTCCCGGCATTCGCCATCCAGGATCCCGCAAAGAACGCCAAATACCCCTATGACCAGGCCAAG
GAATTGAATGCCGACGAGGTTGAAAAGTTCATCCAGGATGTTCTGGATGGGAAGGTCGAGCCTAGCATCAAGTCG
GAACCTGTTCCCGAATCTCAGGAGGGCCCCGTCACGGTTGTAGTGGCCCATTCCTACAAGGATCTCGTCATTGAC
AATGACAAGGATGTCTTGCTCGAATTCTACGCACCTTGGTGTGGACACTGCAAAGCTCTTGCTCCGAAGTACGAT
GAGCTCGCAGCTCTCTATGCTGACCACCCCGATTTGGCGGCTAAGGTCACCATCGCTAAGATCGATGCGACGGCC
AACGATGTTCCGGACCCGATTACCGGATTCCCTACCCTCAGACTCTACCCGGCCGGTGCCAAGGACTCCCCCATT
GAGTACTCTGGCTCGCGCACTGTCGAGGATCTTGCCAACTTTGTGAAGGAGAATGGCAAACACAACGTTGACGCC
CTCAATGTCGCTTCCGAGGAAACACAGGAGGGTGGTGATGTGACTGAGGCTGCTCCCTCCGCTACGGAGGCCGAG
ACCCCGGCTGCCACAGATGACGAGAAGGCAGAACATGACGAACTGTAA
Gene >Ani_SJS72_1|g4045.t1
ATGCGCTCCTTCGCGCCTTGGCTCGTTAGCCTTCTCGGAGCATCCGCGGTGGTTGCGGCTGCTGATACCGAGTCT
GATGTTATTTCACTGGATCAGGACACATTTGAGAGCTTCATGAACGAGCACGGTCTCGTGCTTGCCGAATTCTTT
GCTCCTTGGTGTGGCCACTGTAAAGCCCTCGCACCAAAGTATGAGGAAGCAGCTACGGAGCTCAAGGCGAAGAAT
ATCCCTCTGGTGAAGGTTGACTGCACCGCCGAGGAGGATCTCTGCCGGAGTCAGGGCGTTGAAGGCTACCCTACC
CTCAAGATCTTTCGGGGTGTTGACTCTAGCAAGCCTTACCAGGGCGCTAGGCAAACAGAATCGTGAGTCCTCTTG
GTTTTGACTGGACGAAAGAAATGGATATGCATCAAAAGGCTATCGTGTATGTGATGTGCTACTGACCCATCGGAC
GGTTTCCCAGAATCGTTTCCTACATGATTAAGCAGTCACTTCCTGCAGTATCCTCCGTGAACGAGGAGAATTTAG
AAGAGATCAAGACCATGGACAAGATTGTCGTGATCGGTTATATCCCGTCCGACGACCAGGAAACTTATCAAGCAT
TCGAAAAATATGCTGAGTCTCAGCGGGATAACTACCTCTTTGCTGCCACGGACGATGCCGCCATTGCGAAATCGG
AAGGTGTCGAGCAGCCCTCCATCGTGCTCTATAAGGACTTCGATGAGAAGAAGGCTGTTTACGATGGCGAGATCG
AACAGGAGGCTATTCACAGCTGGGTGAAATCCGCTAGTACTCCCCTTGTGGGCGAGATTGGCCCTGAGACCTACT
CTGGCTATATTGGGGTAAGTTGAATCTATACGTCGACGTGACATCTCTTTGCATTTCGGCTTGAGTTTCGATACC
AATTTGCTGGCTGAACTGGCTAACCACTTTTCTTATAGGCTGGAGTCCCATTGGCCTATATCTTTGCCGAGACCA
AGGAGGAGCGCGAAAAGTACACCGAAGACTTCAAGCCTATTGCCCAGAAGCACAAGGGTGCTATCAACATTGCTA
CTATTGACGCCAAGATGTTCGGTGCCCACGCTGGAAACCTCAACCTAGACTCTCAGAAGTTCCCGGCATTCGCCA
TCCAGGATCCCGCAAAGAACGCCAAATACCCCTATGACCAGGCCAAGGAATTGAATGCCGACGAGGTTGAAAAGT
TCATCCAGGATGTTCTGGATGGGAAGGTCGAGCCTAGCATCAAGTCGGAACCTGTTCCCGAATCTCAGGAGGGCC
CCGTCACGGTTGTAGTGGCCCATTCCTACAAGGATCTCGTCATTGACAATGACAAGGATGTCTTGCTCGAATTCT
ACGCACCTTGGTGTGGACACTGCAAAGCGTATGTCTCTTCGATCCCCTAAGTACACTAGGTGTTGGAGCACAATC
AACTAACAGCAAATCTATAGTCTTGCTCCGAAGTACGATGAGCTCGCAGCTCTCTATGCTGACCACCCCGATTTG
GCGGCTAAGGTCACCATCGCTAAGATCGATGCGACGGCCAACGATGTTCCGGACCCGATTACCGGATTCCCTACC
CTCAGACTCTACCCGGCCGGTGCCAAGGACTCCCCCATTGAGTACTCTGGCTCGCGCACTGTCGAGGATCTTGCC
AACTTTGTGAAGGAGAATGGCAAACACAACGTTGACGCCCTCAATGTCGCTTCCGAGGAAACACAGGAGGGTGGT
GATGTGACTGAGGCTGCTCCCTCCGCTACGGAGGCCGAGACCCCGGCTGCCACAGATGACGAGAAGGCAGAACAT
GACGAACTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail