Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g3665.t1
Gene name
Locationscaffold_021:34793..35519
Strand-
Gene length (bp)726
Transcript length (bp)726
Coding sequence length (bp)726
Protein length (aa) 242

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 9.1E-19 72 212
PF06293 Kdo Lipopolysaccharide kinase (Kdo/WaaP) family 1.1E-07 133 192
PF01636 APH Phosphotransferase enzyme family 2.1E-06 150 190
PF03109 ABC1 ABC1 atypical kinase-like domain 1.5E-05 122 198
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 2.2E-05 73 207

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0030554 adenyl nucleotide binding No
GO:0003674 molecular_function No
GO:0019538 protein metabolic process No
GO:0043168 anion binding No
GO:0032553 ribonucleotide binding No
GO:0005488 binding No
GO:0006796 phosphate-containing compound metabolic process No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0043412 macromolecule modification No
GO:0006793 phosphorus metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0008152 metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0008150 biological_process No
GO:0016310 phosphorylation No
GO:0017076 purine nucleotide binding No
GO:0016301 kinase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043170 macromolecule metabolic process No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0044238 primary metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0036211 protein modification process No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup7973
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g10277.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g2490.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g2940.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g3305.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g1254.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g8192.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g10285.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g6403.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g3212.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g1755.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g8321.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g10579.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g9703.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g10585.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g9407.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g3665.t1 (this protein)
Aspergillus niger CBS 147346 Ani_SJS75_1|g9769.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g6757.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g8196.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g774.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g10448.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g6749.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g6515.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g962.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g3665.t1
MKFSYVEVFVRQDGILYSGKWTDRFQSPKTLEDLDEVKQIQTADRGPEVKASWSAVYVKTPSLLAYVNGDLEKQI
TREVETCEILLRHPHPNIATYYGYMETNGRVSGLCFKRYTSTLLEAVNPQRLNKVAFLSSARELVKENMKRGLEG
ILSAIKHLHSFGLVHNDINPANIMLDEDGRLVLIDFDSCRFIGESLRHTEAKRTHQWHDPSVDISVEKNDLDAFR
DLKIWLAGSVDEVFLF*
Coding >Ani_SJS72_1|g3665.t1
ATGAAATTTTCCTATGTCGAGGTTTTTGTCCGGCAAGACGGCATTCTGTATTCTGGAAAATGGACGGATCGATTC
CAATCGCCGAAGACGCTGGAAGATCTAGACGAGGTCAAGCAGATCCAAACAGCGGATAGGGGCCCAGAGGTGAAA
GCCAGTTGGTCAGCGGTCTACGTGAAAACCCCAAGTCTACTGGCGTATGTCAATGGAGATCTCGAAAAGCAAATC
ACTCGCGAAGTGGAAACATGCGAAATTCTTCTCAGGCATCCCCATCCGAACATCGCGACCTATTATGGCTATATG
GAGACTAACGGCCGGGTCTCTGGGCTATGCTTCAAGCGATATACATCTACGCTACTTGAAGCGGTCAACCCTCAA
CGCCTTAACAAGGTCGCTTTCCTTTCAAGTGCTCGTGAGCTGGTAAAAGAAAATATGAAGAGGGGCCTAGAAGGG
ATTCTGTCTGCCATCAAGCATCTTCACTCGTTTGGACTTGTCCATAACGACATCAACCCGGCCAACATTATGCTT
GATGAAGATGGTAGGCTTGTTCTCATCGATTTCGATAGTTGTCGGTTTATCGGAGAGTCGTTGAGACACACCGAA
GCGAAAAGAACACACCAATGGCATGATCCTTCTGTCGATATCTCGGTGGAGAAGAATGACCTTGACGCGTTTAGA
GATTTGAAAATTTGGCTGGCTGGATCGGTGGATGAAGTCTTTCTTTTCTAA
Transcript >Ani_SJS72_1|g3665.t1
ATGAAATTTTCCTATGTCGAGGTTTTTGTCCGGCAAGACGGCATTCTGTATTCTGGAAAATGGACGGATCGATTC
CAATCGCCGAAGACGCTGGAAGATCTAGACGAGGTCAAGCAGATCCAAACAGCGGATAGGGGCCCAGAGGTGAAA
GCCAGTTGGTCAGCGGTCTACGTGAAAACCCCAAGTCTACTGGCGTATGTCAATGGAGATCTCGAAAAGCAAATC
ACTCGCGAAGTGGAAACATGCGAAATTCTTCTCAGGCATCCCCATCCGAACATCGCGACCTATTATGGCTATATG
GAGACTAACGGCCGGGTCTCTGGGCTATGCTTCAAGCGATATACATCTACGCTACTTGAAGCGGTCAACCCTCAA
CGCCTTAACAAGGTCGCTTTCCTTTCAAGTGCTCGTGAGCTGGTAAAAGAAAATATGAAGAGGGGCCTAGAAGGG
ATTCTGTCTGCCATCAAGCATCTTCACTCGTTTGGACTTGTCCATAACGACATCAACCCGGCCAACATTATGCTT
GATGAAGATGGTAGGCTTGTTCTCATCGATTTCGATAGTTGTCGGTTTATCGGAGAGTCGTTGAGACACACCGAA
GCGAAAAGAACACACCAATGGCATGATCCTTCTGTCGATATCTCGGTGGAGAAGAATGACCTTGACGCGTTTAGA
GATTTGAAAATTTGGCTGGCTGGATCGGTGGATGAAGTCTTTCTTTTCTAA
Gene >Ani_SJS72_1|g3665.t1
ATGAAATTTTCCTATGTCGAGGTTTTTGTCCGGCAAGACGGCATTCTGTATTCTGGAAAATGGACGGATCGATTC
CAATCGCCGAAGACGCTGGAAGATCTAGACGAGGTCAAGCAGATCCAAACAGCGGATAGGGGCCCAGAGGTGAAA
GCCAGTTGGTCAGCGGTCTACGTGAAAACCCCAAGTCTACTGGCGTATGTCAATGGAGATCTCGAAAAGCAAATC
ACTCGCGAAGTGGAAACATGCGAAATTCTTCTCAGGCATCCCCATCCGAACATCGCGACCTATTATGGCTATATG
GAGACTAACGGCCGGGTCTCTGGGCTATGCTTCAAGCGATATACATCTACGCTACTTGAAGCGGTCAACCCTCAA
CGCCTTAACAAGGTCGCTTTCCTTTCAAGTGCTCGTGAGCTGGTAAAAGAAAATATGAAGAGGGGCCTAGAAGGG
ATTCTGTCTGCCATCAAGCATCTTCACTCGTTTGGACTTGTCCATAACGACATCAACCCGGCCAACATTATGCTT
GATGAAGATGGTAGGCTTGTTCTCATCGATTTCGATAGTTGTCGGTTTATCGGAGAGTCGTTGAGACACACCGAA
GCGAAAAGAACACACCAATGGCATGATCCTTCTGTCGATATCTCGGTGGAGAAGAATGACCTTGACGCGTTTAGA
GATTTGAAAATTTGGCTGGCTGGATCGGTGGATGAAGTCTTTCTTTTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail