Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g361.t1
Gene name
Locationscaffold_002:73005..87237
Strand-
Gene length (bp)14232
Transcript length (bp)14121
Coding sequence length (bp)14121
Protein length (aa) 4707

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 4.4E-66 239 682
PF00501 AMP-binding AMP-binding enzyme 2.8E-58 1397 1788
PF00501 AMP-binding AMP-binding enzyme 7.6E-70 2505 2910
PF00668 Condensation Condensation domain 1.7E-31 936 1364
PF00668 Condensation Condensation domain 1.1E-15 2037 2469
PF00668 Condensation Condensation domain 9.6E-33 3157 3570
PF00668 Condensation Condensation domain 4.6E-45 3705 4120
PF00668 Condensation Condensation domain 9.4E-26 4291 4608
PF00550 PP-binding Phosphopantetheine attachment site 1.3E-08 825 890
PF00550 PP-binding Phosphopantetheine attachment site 3.1E-07 1932 1995
PF00550 PP-binding Phosphopantetheine attachment site 6.3E-06 3054 3115
PF00550 PP-binding Phosphopantetheine attachment site 3.3E-09 3599 3662
PF00550 PP-binding Phosphopantetheine attachment site 2.0E-09 4159 4222
PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain 7.7E-07 691 773

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g361.t1
MAAPVVPVTRVPALDTLDQYVVGKAAADKAAISPSVELTCSSDYCDIANSLIEGYARFISRLTGLEDVAFFVSRQ
SSIASESDLLRGVVSASVLAAEEGQQPRCVFREDSEQHADEGEVQFSLDLGLYVGPENGEQQPLVGVRDSAFTTF
IRPTTTKDTLEISFAYPTRLIPEPAVDQLLRILATQLADSTTFLTFDAPSPNLSVLNFPPLMIPPLRETDQVDFP
ESGHSKQYLLHVAFEGWARRKPDAIALDFVHSLPSATAAAEHSLLTYAALNQAATILAVHIRALLLAKNAADYGR
IIPVYMPSCPELYITYLAVLKAGFAFSPIPQDAPVQRVRDVLEDIDCPIILGNTPEPVSGPWCDASAGSTIKQVW
VDVAEASRWKSLRDGQSESSEHGEPLEQLDIEHDQTAYLLFTSGSTGKPKGVQISHLAAACSIEAHATEVPIPGE
EIDDFRWFQFCAPTFDPSLAEIFVTLGCGATLCSADRSLTLTDLEATINEARATVMMATPSLAALLRPERLTTLQ
YLWCIGEKLNRTVIENFSAKPGTNGGITVSEPSRMLVNTYGPTEATIACTYLAPFGHSLRCSIIGQALATCSMFV
LDPNSREPRAVPAGLAGELAIGGPQLSKGYLNRPVETAKAFVDSGEFGRLYRTGDMARMVWDESGSQIIEFLGRI
TSDQVKISGRRLELGEIESVLETVRGANEVVAVVSKRDANVQGSEQIVACLVANGSIEAEREDIIWEAHHNSEKH
LSSYMCPSAYVFLDALPRSSAGKVDRKAVTARLQQGSGGDIRLYPAPKLKPAETNGIHDDWNFLIDEDLLSIQQL
IVGLIAEATDESVSAIKPGTDLYSLGIDSLGAMRLLQKLRDHSIEGLSVGDVLQSGTPKALVNAVAQQRQSNGIP
QVNGSDETLQHSLSAFQDRNHTICAERLGMTPEKIQKVLPTTATQSGILTSFLRSSSDAAFATRSYIYHSVLPLE
PGVDIDRIKAAWETVIASYDSFRTVFCWLDDDMAPFAQCILAPTAVSGTRWNTYHSTKQSSDENVLQQALQEAEE
SIELGTPPWRLSLVTSPASTRIILSMFHGIFDGGSLQLLLEDVSCVYSGNTPAQRVSLEHLVKHHFQADHAATAK
FWGEHLESYSPVWFPSVTPYRTPPTKKTGCVEITARTSYDRLKRESKLIGSTPLSVLQAAWGSVLLAYTGTPAQD
VVMGSVVSGRLDVDSEACVGPTFTTVPIRLSLSQIQQDSQKSWTNRSVARHLTTFNAQTLSHLQPRLGSLVTADG
RLPYDTLIAYQDFNAGSSVSGLWSSVDHPAMANDFAVMIEIWPAANSSLTFRASFNDALLDRNSAEMMLWQMSDI
VAYILEQPDESFQDAPSHTETGLKSSFNSKPSIAPEVLDGALLHSQFEEHAASHPEDPALIFRYDLDDESNPRNI
TWSYAGLNALADKLAEHLLQTGARVANSPIPICIEKSPALYVAILGILKAGGAWCPIDTLSPAQRRHDLIARTGS
TILLVSSVDGEQPDGSIPIGVETIDVGKFTIDEPIYANGVVRGASRDRATPDGMAYLIWTSGTTGAPKGVPIKHS
SAVSSMKSLQKDIPTDVAGGDIFYTWGVGGVLISASREIMLGSFSKLANTTNATHAHLTPAFSAGVSRKSCPTLQ
VITMIGEKLTQPVADDWGTDMRAFNTYGPAEVTVVSTIREFGNEHKNIKSANIGWPMDTVSVFVTNKQRLIMKNA
IGELALGGPQLSPGYLNQEDVTKAKYVWNEEVGQMVYYTGDLVRMLADGSLEYINRVDDLVKLGGIRVELSEISF
SLGECHPLVENIETLILNRPDRPNKVVVAFLSASKATRTEDEQLLMIDKAALEIARAASEKAQSVLPDHMIPSVY
LVVSHIPRTSSAKTDRRALEAAYAGVDIDSWEKEMNPEIKSSAADSQDQHTATITHRVVEMISTLANISQSIITK
SSRLGSLGIDSIRAIRLASRLKEAGHQLSVVEVLNCVTVQDLVQLASSSTVVEKPTFETFDVRAFHDTWHTATVS
KVPEGFITVRATTIQESLLSETMGTYNRYWSNHFFLLDSSVDATRMKQAWLATSQKVEALRTGFIPVAEVDDGKS
RSQGKLDFSILQIIYTLPDVDWEYINCSEQDLVEHRENRIEEIMTKHQKNYFKYPPWAVTVFDTGKRQLMILTLH
HSIHDEPSLGLIMDDVRSAYAYKPPQRHQLSDALSIVLPGENRSKETRSFWKTELKKFAELDAPVWPDLTGKRLQ
PGEVPKHILITEESPLTEPVDNLQSFAAQLGVSSIALIIRAAWAYVSLAYLGLPATVFAETLSDRVLHADLEDCI
GPLISVVPIPFHPTGNTRELLTKQHRISVQSWKYRHIHAREVRKILKRPRGEALYPAVFNFHVAKEEGANVTQPS
IWRELEDEVGLHVEHPMAMNVFQHMDGSIVLEATADSSIMCRAQLSLFIRQIDGLISSMLASPDQPLASLINRFP
SPLRSLSNQPVREEVVKSVRLSPTHWLEVYAKNHPEWTAVEVASEISSNGIVKEAMTFGTLNSEANRVAAYLASL
GHKNRMIGVCIGRNLPSYPIIIGIFKSGNAYLPIEENLPEDRKAFLIKDSDCPIVFTETAFVSTFQSTPEGCRVI
TIDNSELLGSLATMPTEDQDYNSDPNDLAYLLFTSGSTGKPKGVMVTRGNLSSFIESISVFTGRYAPATYDLGGT
GRYLAQASRAFDPHLLEMLFPWRHGMATVTAPRMMILDDLGITLSKWDITHASLVPSLLDQANIVPEQCPKLRFM
TVGGEKISQKVLDTWAGTPNMALINAYGPTEVTIGCTFAPVGKDTNLRNIGPPLAACVSHVLVPGTLNYALRGQA
GELCFSGDLVGRGYLNRPDATGFITGPNGEKMYRTGDLGRMMPDDSVEYLGRGDDQTKIRGQRLELGEVSEVLRS
SSTVGVDVVTTVAKHPGLSRVQLISFIARSEARQRVKSGDVTFVMSDFATLGKELRDSCKRKLPGYMVPELILPI
TYIPLAPMSGKANIKELHGLFSSLPLPTVLQGNSSASKDGVVIERSLTADEEAVIKEVLDVVSADPSIVGPMTNI
FEIGLDSLSAIGLTIKLRRIGYEVTVAMVMSNPIIEQLARLPRGSSDAESAVSQTRQAFQNIESQYRQQPSPGVN
PSDVDTVRPCLPLQEGLVARSINSESDQLYVNHIALKLEACVDSERLKSAWQAVSNDTEILRTSFAPLDKQMVQV
VYTVDSHQFPWKEEEYESLNEAIEHNKAQQKQISEDIIANISTVPPVRFLIAKSSETKEPLALFINIHHALYDGE
SFTMIMEDVAARYADQPILQRGSPAAFVEYVYSQDSEKAKQHWVRYLEGCHPTTFRTDFNAMEPPVVVHRSLGVK
LSELEHRSAALQTTVPSLVQAIFALLLADTVGVSDLTYGLVLSGRAVSVPGASSVLLPCITTVPGRLNTASLGTV
DDVVADVQKSTVGSLDFQHTPLRHIQRWINAETPLFDCLFSYIRTAAPPEHRLWQELNSNMPAEYPLAVEVEANH
SMDTVQLNCFFSSAFGSLYSGSELIEKMDAVLSSIAAGQSLSLDDFNVSHSAASGSRPAVLWDNTTWSTAETTIR
EYTMSFCGLTSAEVTKGASFLSLGVDSVTAIQFARQLREAGLQVSSADIMRFSCVGALAQHVEQKTRSQTPVNGT
NGHEKTITGIPIETYGENVRLLAEDDSISTMFETTPLQSGMITQTIASSGKVYAHPHIIRLKDSVDTTRLKEALF
RVIDANDILRTSFHLIAELGSSWIAAVHTNPPFQWEELTLPSGADVLTEVDSLYDFSEEASFEVPPIRSALVNQP
EGKLLVVVLHHALYDGSSIPFLFEDLAVCYEESSLPIRPQFSETVQHLLSGQEKACEFWTERLLGYEATELPELP
HPESSDRMLLSECRVDLDLSAIVDACKAMEVTVQSVSLLAYAKVLAGVVGKRDVVFGQVLAGRSLPVAGAERTLG
PMFNTVAQRVSFEPKFLSNKAMAQRLQQHTIDSQSHQNAPLRLVQNSFRQANNSISSMLFDTLFVFQKSADFAGS
IIEEQQIWTPYEADDYAAQAEYKLNVEVDHACDGLVVQATCNGRYISQETLDQLMDEFAIAFRDIIEHPTRCATI
VPQGLGELPTKLSVEQSLDPDVESSEVPSHEAIIQSVLAEIAGIPVDNIKPNTSIFNIGLDSLTAIRIASICRSK
GLKIGVADILQGNTLRGISQRIQPLSEQAIQPRGSFIKNYTEVETTVLQQLNLSKDSIEAILPCLGGQFYHLVSW
LKSGRKLLEPAWAYACSGRIDSTKIEEAWFQLRQRHPILRTCFAAISSSEAVQVVHKQAMRGAGTFQVIETATPL
SEAAQAQAREEALHPSSLFTPPVRLRLLKASDNDGILLLINHAAYDAWTMPMFVKELAELYNGQRPATNTDFPAF
VDFSMCSLQSLDEKQYWNTTLGDASPTIIRNTRTETQPTPDQLFIGVWEKVKDLSQLETKCRSSNVSLQTVVLFA
IARCIARLTDVQNPTMGLYQAGRSASFNNVENLSGPCLNVNPFTIPNADTNPIDTDLLTQVRAIQSSLADRVSYE
QSSLRNILQWISPEKPLFNTWVNLLWTQNTISSNANSTSDGTEDFFSPLRIGVPTDFIPEQPLAEEVTAVSALDT
EFLPSENVFIDVGPDAKTDSIGFGVRVEGGVMSVEEVHKLVDEITGEIERIMGMLA*
Coding >Ani_SJS72_1|g361.t1
ATGGCTGCTCCAGTCGTCCCTGTCACCAGAGTTCCTGCCCTGGACACGCTCGATCAATATGTTGTGGGAAAAGCC
GCGGCCGATAAGGCGGCGATCAGCCCATCCGTCGAGCTTACCTGCAGCTCCGACTACTGCGACATCGCAAATAGC
CTGATCGAAGGCTACGCCCGTTTTATCTCTCGTCTAACTGGTTTGGAGGATGTCGCCTTCTTCGTGTCGCGTCAG
TCAAGCATCGCCAGCGAGTCCGATCTGTTGCGCGGGGTCGTTTCGGCTTCCGTGCTGGCCGCGGAGGAGGGGCAA
CAACCACGTTGCGTTTTCCGCGAAGACAGTGAACAACACGCAGATGAGGGAGAGGTACAGTTTTCTCTGGACTTG
GGCTTGTATGTCGGTCCTGAAAATGGCGAGCAACAACCCCTTGTTGGAGTTCGAGACAGTGCCTTCACGACATTC
ATTCGACCTACCACCACGAAAGATACCCTCGAAATCAGTTTTGCCTATCCGACACGCCTTATACCTGAGCCGGCA
GTGGATCAGCTACTCAGAATTCTTGCCACACAACTGGCAGACTCAACCACTTTCCTTACCTTTGACGCTCCGTCG
CCCAATCTTTCAGTCTTGAATTTTCCTCCCCTTATGATACCCCCTTTGCGAGAGACGGACCAAGTTGATTTTCCC
GAGTCTGGCCATTCCAAACAATATCTTCTCCATGTCGCTTTCGAGGGCTGGGCCCGTCGAAAACCTGATGCCATA
GCGCTGGATTTTGTTCATTCTTTGCCTTCTGCCACGGCTGCGGCAGAACACAGCCTTCTTACTTATGCCGCACTT
AATCAAGCAGCCACTATCCTCGCTGTACATATTCGAGCCCTTTTGTTGGCGAAGAACGCCGCCGACTATGGACGC
ATCATCCCTGTTTACATGCCATCGTGTCCGGAACTTTACATTACATATCTCGCCGTTCTCAAGGCTGGTTTCGCT
TTCTCTCCGATACCCCAGGATGCACCGGTACAACGGGTTCGTGATGTCCTAGAAGACATCGACTGTCCGATTATA
CTTGGCAATACCCCAGAGCCCGTCTCTGGGCCATGGTGCGATGCTAGCGCCGGTTCAACCATCAAGCAGGTTTGG
GTTGACGTAGCGGAGGCCTCAAGATGGAAGAGCTTGCGTGATGGTCAGTCCGAGTCCTCGGAGCACGGCGAGCCT
CTGGAACAGTTAGACATCGAGCATGACCAAACTGCGTACCTCCTATTCACCAGCGGCTCTACTGGAAAGCCAAAG
GGTGTTCAGATCAGTCACCTAGCTGCCGCCTGCTCCATTGAAGCTCATGCTACAGAAGTTCCTATTCCGGGAGAA
GAAATTGACGATTTCCGCTGGTTTCAATTCTGTGCTCCAACCTTTGACCCTTCCCTAGCGGAGATATTTGTAACC
TTGGGTTGCGGTGCCACTCTCTGCTCGGCCGACCGCAGCTTGACGCTAACCGACCTGGAAGCGACCATCAACGAA
GCTAGAGCAACTGTGATGATGGCTACGCCTAGCTTGGCTGCCCTTCTTCGGCCGGAACGGCTAACCACGCTCCAA
TACCTCTGGTGTATCGGTGAAAAGCTTAATAGAACCGTCATCGAAAACTTCTCCGCAAAACCTGGTACAAATGGA
GGGATTACTGTATCCGAGCCCTCGCGGATGTTGGTCAATACCTACGGTCCGACTGAAGCAACGATTGCCTGTACT
TACCTGGCACCATTTGGCCATTCCCTCCGCTGCTCCATAATTGGCCAAGCGCTAGCAACCTGTTCAATGTTTGTT
CTCGACCCCAACAGCCGTGAGCCTCGAGCGGTTCCTGCTGGTCTTGCCGGTGAACTAGCAATTGGTGGCCCGCAG
CTCAGCAAAGGTTATCTCAACCGTCCGGTAGAAACTGCAAAGGCGTTCGTTGATAGTGGCGAGTTCGGTCGCTTG
TACCGGACTGGTGACATGGCACGGATGGTTTGGGACGAATCTGGTTCCCAGATCATTGAATTCCTTGGTCGTATC
ACGTCTGACCAAGTCAAAATTAGCGGTCGGCGACTCGAACTAGGCGAGATCGAATCAGTCCTCGAGACTGTACGC
GGTGCCAACGAGGTTGTAGCCGTGGTTTCCAAACGCGATGCTAATGTCCAGGGAAGTGAACAGATCGTCGCATGC
CTCGTTGCAAATGGCAGCATTGAAGCGGAGAGAGAGGATATTATCTGGGAGGCACATCATAATTCCGAGAAACAT
CTCTCTTCTTACATGTGTCCGTCTGCTTACGTTTTTCTCGATGCTCTCCCTCGGTCCAGTGCCGGGAAAGTCGAT
CGCAAAGCGGTAACTGCAAGGCTGCAGCAGGGTTCGGGGGGCGATATCAGACTATATCCTGCACCCAAATTGAAG
CCTGCGGAAACGAATGGGATTCATGATGACTGGAATTTCCTTATTGATGAAGACTTGCTGTCCATTCAGCAGCTT
ATAGTTGGCCTCATTGCAGAGGCAACGGATGAGAGTGTTTCTGCCATCAAGCCTGGGACCGACCTGTATTCACTG
GGTATCGATAGTCTGGGTGCAATGCGGCTTCTGCAGAAGCTTAGGGACCATTCTATAGAAGGTTTATCGGTTGGT
GACGTTCTACAGTCTGGAACCCCCAAAGCATTGGTCAACGCCGTCGCTCAGCAACGTCAATCAAACGGTATCCCC
CAGGTCAATGGCTCGGATGAGACCCTCCAACACAGTCTTTCAGCCTTTCAAGATCGGAATCACACAATTTGCGCT
GAGAGACTGGGCATGACTCCTGAGAAGATCCAAAAGGTGCTTCCAACAACCGCGACACAGTCTGGCATATTGACT
AGTTTCCTGCGCAGCTCATCTGACGCAGCCTTTGCGACTCGCTCATACATCTATCATTCTGTTTTACCACTCGAA
CCGGGAGTGGACATAGATCGTATCAAAGCTGCGTGGGAAACCGTCATTGCAAGCTACGACTCCTTCCGGACAGTT
TTCTGCTGGCTTGATGACGATATGGCACCATTTGCTCAGTGCATCCTCGCTCCCACAGCAGTCTCAGGGACGAGG
TGGAATACCTATCATTCCACGAAGCAGTCTTCAGACGAAAACGTGTTGCAGCAGGCCCTCCAAGAAGCAGAGGAG
TCAATTGAGCTAGGCACACCACCTTGGAGGTTATCACTGGTAACATCTCCGGCATCTACTCGAATAATCTTGAGC
ATGTTTCATGGTATTTTCGATGGCGGATCATTACAGCTCTTGCTCGAGGACGTGTCTTGTGTGTACTCGGGGAAC
ACGCCAGCACAGCGCGTTTCTCTCGAGCATCTTGTGAAGCATCATTTCCAGGCTGACCATGCAGCAACCGCCAAA
TTCTGGGGGGAGCATCTGGAAAGCTATTCTCCTGTCTGGTTCCCATCTGTCACGCCTTACCGTACCCCACCAACA
AAGAAAACTGGATGTGTGGAAATCACGGCTCGCACAAGCTACGACCGCTTGAAACGAGAGTCTAAGCTCATCGGC
TCAACACCGCTTTCAGTGCTCCAAGCAGCTTGGGGGTCGGTCCTCCTGGCTTACACTGGAACTCCAGCTCAGGAC
GTAGTTATGGGCAGTGTCGTATCTGGTAGGCTTGACGTGGACTCAGAAGCCTGCGTTGGTCCGACATTTACCACT
GTCCCGATCAGGCTTTCCCTGAGCCAAATCCAACAAGACTCCCAGAAGTCGTGGACAAACCGCTCGGTCGCGCGC
CATCTGACAACTTTTAATGCACAGACACTATCTCACCTACAACCTCGGCTAGGATCGCTAGTAACGGCGGATGGC
CGGCTTCCATACGATACCCTCATCGCCTACCAAGACTTCAACGCTGGCTCCAGTGTTAGTGGTCTCTGGAGCTCA
GTCGACCATCCGGCCATGGCGAACGATTTTGCTGTTATGATCGAGATATGGCCCGCTGCTAATTCATCTCTGACA
TTCCGGGCTAGTTTCAACGACGCTCTGCTTGATCGTAACTCCGCCGAAATGATGCTCTGGCAGATGTCTGACATT
GTCGCTTACATACTAGAGCAGCCCGATGAGAGCTTCCAAGATGCCCCATCTCATACGGAGACTGGGCTAAAGTCG
AGCTTCAACTCCAAGCCGTCTATCGCTCCCGAAGTACTAGACGGTGCACTTCTTCATTCCCAGTTCGAGGAGCAT
GCAGCGTCCCATCCAGAAGATCCTGCCTTGATCTTCAGGTACGACTTAGATGACGAGAGCAACCCACGAAATATC
ACGTGGTCCTACGCCGGGCTCAACGCTTTGGCCGACAAACTCGCAGAGCATCTGCTTCAGACTGGCGCACGAGTG
GCAAACTCGCCGATACCTATTTGTATCGAGAAGAGCCCGGCCTTGTATGTTGCCATTCTTGGCATTCTCAAAGCT
GGTGGTGCTTGGTGCCCGATTGATACGCTCTCTCCTGCACAACGTCGCCACGACCTCATTGCACGGACCGGTTCA
ACAATCCTTCTGGTCTCTAGTGTAGATGGAGAGCAGCCAGATGGTTCAATTCCCATTGGTGTCGAGACAATTGAC
GTTGGCAAATTCACCATCGACGAACCCATCTATGCGAACGGAGTGGTACGGGGCGCGTCTAGGGACCGGGCTACT
CCTGATGGCATGGCGTATCTCATCTGGACGAGCGGTACAACAGGAGCACCGAAAGGTGTCCCGATCAAGCATTCT
TCGGCTGTCTCGAGTATGAAATCACTTCAGAAGGATATCCCTACTGATGTAGCTGGCGGGGACATCTTCTACACC
TGGGGTGTGGGGGGCGTTCTTATCTCTGCATCGAGAGAGATCATGCTTGGTTCGTTCTCAAAGCTTGCGAACACC
ACGAATGCCACACACGCACACCTGACTCCAGCCTTCTCGGCAGGTGTCTCCCGAAAATCATGCCCGACACTTCAA
GTAATCACTATGATCGGTGAGAAGCTGACGCAACCTGTGGCCGATGACTGGGGTACCGATATGAGAGCATTCAAT
ACTTACGGGCCCGCCGAAGTGACAGTGGTTTCCACGATCAGGGAGTTTGGTAACGAACACAAAAACATCAAGAGC
GCGAACATTGGCTGGCCTATGGATACTGTGTCTGTGTTTGTAACAAACAAGCAGCGGCTCATCATGAAGAATGCT
ATAGGCGAGCTGGCGCTGGGCGGACCACAACTTTCTCCTGGTTATCTGAATCAAGAGGATGTCACCAAGGCCAAG
TATGTCTGGAACGAAGAGGTTGGTCAGATGGTGTACTACACTGGAGATTTGGTTCGCATGCTTGCTGACGGATCC
CTGGAGTACATCAATCGTGTTGATGACTTGGTCAAACTGGGAGGTATCAGAGTGGAGCTGAGCGAGATCAGCTTC
TCGCTCGGCGAGTGCCATCCTCTGGTTGAGAATATTGAGACGCTTATTCTCAACCGCCCAGACCGGCCTAACAAG
GTTGTGGTCGCCTTCCTCTCTGCTTCGAAAGCTACACGCACCGAAGACGAGCAGCTCTTGATGATCGATAAGGCG
GCGCTTGAGATTGCCCGTGCTGCCAGCGAGAAAGCACAAAGCGTTCTACCTGACCACATGATACCGTCTGTATAC
CTTGTGGTCTCGCACATCCCGAGAACATCATCCGCCAAGACAGATCGCAGGGCCTTGGAAGCTGCCTATGCCGGT
GTGGATATCGATAGTTGGGAGAAAGAGATGAATCCAGAAATCAAATCTTCTGCAGCGGACTCCCAGGACCAGCAC
ACCGCGACCATAACACACCGGGTAGTAGAAATGATTTCTACCTTGGCCAATATCTCCCAGTCAATTATCACGAAG
TCCAGCCGCCTGGGGAGTCTGGGTATCGACTCTATTCGCGCAATCCGGCTTGCCTCTAGACTCAAGGAGGCCGGT
CATCAATTGTCTGTTGTGGAGGTCCTAAATTGTGTGACTGTCCAGGATCTTGTCCAACTGGCCTCGTCATCTACT
GTAGTGGAGAAGCCCACCTTCGAAACGTTCGACGTTAGGGCATTCCATGACACCTGGCACACAGCCACAGTCAGC
AAAGTACCGGAGGGATTCATAACTGTGCGCGCGACCACGATCCAGGAAAGTCTTCTTAGTGAGACAATGGGTACA
TACAACAGATATTGGAGTAATCATTTCTTTCTGCTTGACAGCTCGGTGGATGCGACGCGAATGAAACAGGCTTGG
CTTGCAACGAGCCAGAAGGTGGAGGCTCTGAGAACTGGCTTTATCCCTGTTGCGGAGGTCGATGACGGGAAAAGC
CGATCGCAAGGAAAACTTGACTTTTCTATATTGCAAATCATTTACACGCTACCAGATGTTGATTGGGAATACATC
AACTGTTCAGAGCAGGATCTGGTGGAGCATCGCGAAAATCGGATTGAGGAGATCATGACCAAACACCAGAAGAAC
TATTTTAAATATCCCCCATGGGCCGTTACAGTATTCGACACAGGCAAAAGGCAGCTCATGATCCTCACCCTCCAT
CATTCGATTCATGACGAACCTTCCCTGGGACTTATAATGGATGATGTGCGATCAGCTTATGCTTATAAACCTCCT
CAAAGACATCAACTCAGTGATGCGCTCTCGATCGTTCTACCAGGAGAAAATCGGAGCAAGGAGACCAGAAGCTTT
TGGAAAACCGAACTCAAGAAATTTGCAGAGCTTGATGCGCCAGTGTGGCCCGATCTCACTGGGAAGAGGTTGCAG
CCAGGCGAAGTCCCCAAGCATATCTTGATTACAGAAGAGTCGCCTTTAACGGAGCCTGTTGACAACCTGCAGTCG
TTTGCAGCCCAACTTGGGGTCTCATCCATTGCCTTGATTATCCGAGCCGCATGGGCCTATGTTTCGCTGGCTTAT
CTCGGTCTTCCAGCGACAGTCTTTGCTGAGACTCTCTCTGACAGAGTTCTGCATGCTGACCTTGAAGACTGCATT
GGACCCCTCATCTCCGTTGTACCTATTCCGTTCCATCCAACGGGAAACACTCGTGAGCTACTTACCAAGCAGCAT
CGCATCTCTGTTCAGTCCTGGAAGTATCGCCATATCCATGCTCGCGAGGTCCGAAAGATTCTCAAGAGACCCAGG
GGTGAGGCCTTATATCCGGCGGTGTTCAACTTCCACGTCGCGAAAGAAGAGGGTGCAAACGTCACTCAGCCTAGC
ATCTGGCGCGAACTCGAAGATGAGGTCGGGCTGCATGTTGAGCATCCCATGGCCATGAACGTTTTCCAACATATG
GATGGCTCTATAGTCCTCGAGGCAACTGCGGACAGCAGCATAATGTGTCGGGCACAGCTGTCACTATTCATTCGT
CAGATTGACGGGCTTATCAGTTCAATGCTCGCATCTCCAGACCAGCCCCTTGCAAGTCTAATCAACCGCTTTCCT
TCGCCATTACGATCGCTATCGAATCAGCCTGTCAGAGAAGAAGTAGTGAAGTCTGTTCGACTGAGCCCTACGCAC
TGGTTAGAGGTGTATGCGAAGAACCACCCTGAATGGACAGCCGTTGAGGTAGCCAGTGAAATTTCCTCAAACGGG
ATTGTGAAGGAAGCTATGACCTTCGGTACATTAAACTCTGAAGCAAACCGTGTTGCGGCCTACCTGGCATCTCTT
GGTCATAAGAACAGGATGATCGGAGTCTGTATTGGGCGAAACCTGCCCTCTTATCCCATCATAATCGGTATCTTC
AAGTCAGGAAATGCTTACCTTCCAATCGAAGAAAACCTTCCGGAGGATCGCAAAGCTTTTCTCATCAAGGATAGT
GATTGTCCTATTGTTTTCACCGAAACGGCGTTCGTGAGCACGTTCCAAAGTACCCCCGAGGGATGTCGCGTGATA
ACCATCGACAACTCGGAGCTCTTGGGCTCACTTGCCACCATGCCAACAGAAGATCAAGACTATAACTCCGATCCC
AACGATCTGGCATATCTTTTATTTACCTCAGGCTCGACAGGAAAACCGAAGGGTGTGATGGTGACCCGAGGCAAC
CTTTCATCTTTCATCGAGTCGATCTCGGTGTTCACAGGCCGGTATGCCCCCGCTACGTATGATCTGGGCGGCACT
GGAAGATATCTCGCGCAGGCCAGTCGAGCTTTTGATCCCCATCTGTTGGAAATGCTCTTCCCATGGCGCCATGGG
ATGGCTACTGTTACAGCTCCTAGGATGATGATTTTGGATGACCTTGGGATAACCTTGTCCAAGTGGGATATCACT
CATGCAAGTCTGGTGCCATCTCTTCTGGATCAAGCAAATATTGTACCAGAGCAATGTCCCAAGTTGAGATTCATG
ACTGTTGGTGGAGAAAAGATTTCACAGAAGGTATTGGACACCTGGGCGGGAACACCAAACATGGCGCTTATCAAC
GCATACGGCCCGACAGAGGTAACCATCGGCTGCACATTCGCTCCTGTCGGAAAAGACACAAACTTGCGCAATATC
GGACCTCCCCTAGCAGCCTGTGTGTCTCATGTCCTTGTCCCTGGTACCCTTAACTATGCTCTGAGAGGCCAGGCT
GGCGAGCTATGCTTTTCTGGAGACCTCGTTGGAAGGGGCTATCTCAACAGACCAGATGCCACTGGCTTCATCACC
GGACCTAATGGTGAAAAAATGTACCGGACTGGTGATTTGGGACGCATGATGCCAGACGACTCGGTCGAGTATCTT
GGGCGTGGCGATGACCAGACCAAGATTCGTGGTCAAAGGCTAGAGCTCGGTGAGGTATCTGAGGTGCTTCGCTCT
TCGTCGACTGTTGGCGTTGATGTTGTCACGACCGTGGCCAAACACCCTGGTCTTTCAAGAGTTCAACTTATCTCG
TTCATCGCGCGGTCGGAAGCCCGTCAACGTGTGAAGAGCGGGGATGTCACCTTCGTTATGTCCGACTTCGCAACG
CTAGGCAAGGAACTTCGAGACTCTTGCAAGAGGAAGCTACCGGGCTACATGGTTCCCGAGCTTATTCTCCCCATC
ACTTATATACCTTTGGCACCGATGTCAGGAAAGGCAAACATCAAAGAGCTACATGGCCTCTTCTCCAGCCTTCCT
CTGCCTACTGTCCTTCAAGGTAACAGCTCGGCAAGTAAGGACGGCGTCGTTATTGAACGGTCTTTGACTGCCGAC
GAAGAAGCTGTGATAAAAGAAGTCCTTGATGTTGTTTCGGCGGATCCTTCGATTGTTGGACCCATGACGAACATC
TTCGAAATTGGCCTCGATAGTCTAAGTGCCATAGGGCTTACGATTAAGCTCCGGAGAATTGGGTATGAAGTCACG
GTAGCCATGGTCATGAGCAACCCGATCATTGAGCAGCTTGCACGCTTACCTAGGGGTTCTTCGGACGCAGAGAGT
GCTGTCTCGCAGACACGTCAAGCCTTTCAAAACATTGAGTCTCAATACCGCCAACAACCGTCGCCCGGTGTCAAC
CCGTCCGATGTGGACACGGTCAGGCCTTGCTTGCCACTTCAGGAAGGTTTGGTTGCTCGCTCAATAAATAGTGAA
AGCGATCAACTCTATGTCAATCACATTGCCCTTAAACTCGAGGCCTGTGTCGATAGTGAGAGGTTAAAATCTGCC
TGGCAAGCCGTCTCCAATGACACCGAAATCCTGAGAACTTCATTCGCTCCTTTGGACAAGCAAATGGTGCAAGTG
GTCTACACGGTCGATTCTCATCAGTTTCCATGGAAGGAAGAGGAGTATGAGAGCCTGAACGAAGCTATTGAGCAT
AACAAGGCACAACAGAAGCAGATCTCTGAGGATATCATTGCAAACATCTCCACTGTCCCACCAGTGCGGTTCCTC
ATAGCCAAATCCTCCGAAACCAAGGAACCGCTTGCCCTCTTCATTAACATTCATCATGCACTCTATGATGGAGAA
TCTTTCACGATGATAATGGAGGATGTGGCAGCGCGCTATGCAGACCAACCTATCCTTCAGAGAGGCTCGCCGGCG
GCTTTCGTTGAATATGTTTATAGTCAGGATTCAGAAAAGGCCAAGCAACACTGGGTCCGCTATCTGGAGGGATGC
CATCCGACAACTTTCCGTACTGACTTCAATGCCATGGAGCCTCCGGTCGTCGTACATAGAAGCCTTGGTGTGAAG
CTTTCTGAACTGGAGCACCGCTCTGCAGCTCTTCAGACCACTGTACCATCCTTGGTGCAAGCGATTTTCGCACTC
TTGCTGGCTGATACCGTTGGTGTGTCAGATTTGACCTATGGGTTGGTCCTGTCCGGTAGAGCCGTGTCGGTTCCC
GGAGCCTCCTCGGTACTTCTGCCTTGCATCACTACTGTCCCTGGTCGTCTCAATACCGCTAGCCTGGGTACAGTT
GACGATGTTGTGGCGGATGTCCAAAAGTCTACGGTGGGGTCGCTTGATTTCCAGCACACACCCCTAAGACATATA
CAGAGATGGATTAATGCGGAGACACCTCTGTTCGACTGTCTATTTTCATATATTAGGACTGCTGCGCCACCAGAA
CACCGCCTGTGGCAGGAACTAAACAGCAATATGCCTGCCGAGTATCCGTTGGCAGTGGAGGTCGAGGCCAACCAT
TCCATGGACACTGTTCAGCTCAACTGCTTCTTTTCATCTGCTTTCGGCTCCCTATACAGTGGAAGTGAATTGATC
GAGAAGATGGACGCAGTGCTCTCGAGCATTGCAGCAGGTCAAAGTCTTTCGCTAGACGACTTCAATGTCTCTCAT
TCAGCAGCATCTGGTTCGCGTCCTGCTGTGCTGTGGGACAACACCACATGGTCCACCGCGGAAACCACGATTCGT
GAATACACGATGTCTTTTTGCGGATTGACTTCGGCCGAAGTCACTAAAGGCGCTTCTTTCTTGAGTTTGGGTGTT
GATTCGGTCACGGCAATTCAATTTGCGCGTCAGCTACGGGAAGCTGGGCTTCAGGTTTCTTCTGCTGATATTATG
CGTTTCTCATGCGTTGGTGCGTTGGCCCAGCATGTGGAGCAGAAAACACGTTCTCAGACCCCGGTTAACGGTACC
AATGGGCACGAGAAGACGATTACCGGTATCCCTATTGAGACCTACGGCGAAAATGTCCGACTCCTTGCAGAGGAT
GACTCGATCTCTACAATGTTCGAAACTACGCCCCTGCAGTCGGGAATGATTACGCAGACAATTGCTTCTAGCGGA
AAGGTGTACGCTCACCCGCACATTATCAGATTAAAAGACTCGGTCGATACTACCCGACTGAAGGAGGCTCTTTTC
AGAGTCATCGATGCAAATGATATTCTGCGGACATCCTTCCACCTGATCGCTGAGCTTGGTTCCTCCTGGATTGCC
GCCGTACACACCAATCCCCCTTTCCAGTGGGAGGAGCTCACATTGCCTTCCGGGGCCGATGTTCTGACTGAAGTC
GACTCTCTTTATGATTTCAGCGAAGAGGCTTCTTTCGAGGTCCCACCTATTCGGTCTGCTCTAGTCAACCAGCCT
GAAGGCAAATTACTGGTTGTTGTTCTGCATCATGCTCTGTATGATGGTTCTTCCATCCCCTTCCTGTTTGAGGAC
CTGGCCGTGTGCTATGAAGAAAGCAGTCTTCCGATAAGACCACAGTTCTCAGAGACTGTCCAGCATCTACTAAGC
GGTCAAGAAAAAGCTTGCGAATTCTGGACAGAAAGACTACTCGGATATGAAGCCACTGAACTTCCTGAGCTTCCT
CATCCTGAGTCGTCAGACCGCATGTTGCTTTCTGAATGCCGGGTTGACCTTGACTTGTCGGCCATAGTGGATGCC
TGCAAGGCAATGGAGGTCACCGTGCAGAGTGTATCTCTCCTGGCCTATGCGAAGGTTCTAGCAGGTGTGGTCGGA
AAACGTGATGTCGTCTTTGGACAAGTCCTTGCAGGCCGCTCGTTGCCTGTTGCTGGTGCCGAACGAACCCTCGGG
CCAATGTTCAATACAGTTGCTCAGAGGGTCTCTTTCGAGCCCAAGTTCCTGAGTAACAAGGCCATGGCCCAGCGC
TTACAACAGCATACAATTGATTCGCAGAGCCATCAGAACGCGCCACTCCGACTTGTGCAGAATTCTTTCAGGCAG
GCTAACAACAGCATATCATCCATGCTTTTCGATACTCTCTTCGTCTTCCAAAAGAGTGCGGACTTCGCTGGCAGT
ATCATAGAAGAGCAACAGATTTGGACACCTTATGAAGCAGATGACTATGCCGCGCAGGCAGAATATAAGCTCAAT
GTTGAGGTCGATCATGCTTGCGATGGACTTGTGGTACAAGCAACTTGCAACGGCCGGTACATCTCCCAGGAAACG
CTTGACCAACTGATGGATGAATTCGCCATTGCGTTCCGTGACATTATCGAGCATCCTACTAGATGCGCTACCATC
GTGCCACAAGGACTTGGTGAGTTACCGACAAAGCTGTCTGTTGAGCAGTCGCTCGACCCCGATGTTGAATCATCC
GAAGTACCATCCCATGAGGCCATCATCCAGTCTGTGCTCGCTGAGATTGCCGGAATTCCTGTGGACAACATCAAA
CCAAACACTAGCATCTTCAATATCGGGCTAGACTCTCTCACAGCTATCCGCATTGCTTCGATTTGCCGATCGAAG
GGTTTGAAAATCGGGGTAGCCGACATCCTTCAGGGGAACACCCTGCGTGGGATCAGCCAACGCATCCAGCCATTG
TCCGAACAGGCAATCCAACCTCGGGGTTCATTTATCAAAAATTACACCGAGGTGGAAACCACTGTGCTCCAACAG
CTCAACCTCAGCAAGGACTCTATCGAAGCCATTCTACCTTGTCTCGGTGGCCAATTCTATCATTTAGTCAGCTGG
TTGAAATCTGGACGGAAGCTGCTCGAACCTGCCTGGGCATATGCCTGCTCCGGGCGCATCGACAGTACTAAAATT
GAGGAAGCTTGGTTCCAGCTCCGCCAAAGGCATCCTATCCTCCGCACCTGCTTTGCAGCTATATCCTCGTCGGAA
GCGGTACAGGTTGTTCACAAACAGGCAATGCGTGGTGCGGGCACATTCCAGGTTATCGAGACCGCTACACCTCTT
TCTGAAGCAGCCCAAGCACAAGCAAGAGAAGAGGCTCTCCATCCATCCTCGCTTTTTACACCTCCCGTCAGACTT
CGTCTATTGAAAGCTAGCGACAACGATGGTATTCTCCTCCTCATAAACCACGCCGCGTATGACGCATGGACCATG
CCAATGTTCGTTAAAGAGCTAGCAGAGCTCTACAATGGCCAACGCCCCGCAACTAACACTGACTTCCCTGCATTC
GTCGACTTCTCAATGTGCTCTCTCCAGAGCCTCGATGAAAAGCAATACTGGAACACTACTCTCGGTGACGCCTCT
CCTACCATCATCCGCAACACTCGCACCGAAACCCAGCCTACCCCAGACCAGCTCTTCATCGGAGTCTGGGAAAAG
GTCAAGGACCTCTCCCAACTCGAGACAAAATGCCGATCCTCCAACGTCAGTCTACAAACCGTGGTCCTCTTCGCC
ATAGCCCGCTGCATCGCACGTCTTACCGACGTCCAAAACCCAACAATGGGTCTCTACCAAGCCGGTCGCTCTGCC
TCCTTCAACAACGTCGAGAACCTCTCCGGACCCTGTCTGAACGTTAACCCATTCACCATCCCTAATGCAGACACC
AACCCCATCGACACTGATCTTCTTACTCAAGTTCGTGCTATCCAATCCTCTCTCGCGGACCGCGTCTCCTACGAA
CAAAGTTCCCTCCGCAACATCCTCCAGTGGATCTCACCCGAGAAACCCCTCTTCAACACCTGGGTGAATCTCCTC
TGGACACAGAACACTATCTCCTCGAATGCCAATTCCACATCAGATGGTACTGAGGACTTCTTCTCCCCGTTGCGG
ATCGGTGTCCCTACAGACTTCATCCCCGAACAGCCTTTGGCTGAAGAAGTCACTGCCGTGTCGGCACTAGATACG
GAATTCCTGCCGTCAGAAAATGTGTTCATTGATGTTGGTCCAGATGCCAAGACGGATTCTATCGGGTTTGGTGTT
CGAGTTGAAGGGGGAGTCATGAGTGTCGAGGAGGTGCATAAGCTTGTTGATGAAATTACGGGAGAGATTGAGAGA
ATTATGGGGATGTTGGCATGA
Transcript >Ani_SJS72_1|g361.t1
ATGGCTGCTCCAGTCGTCCCTGTCACCAGAGTTCCTGCCCTGGACACGCTCGATCAATATGTTGTGGGAAAAGCC
GCGGCCGATAAGGCGGCGATCAGCCCATCCGTCGAGCTTACCTGCAGCTCCGACTACTGCGACATCGCAAATAGC
CTGATCGAAGGCTACGCCCGTTTTATCTCTCGTCTAACTGGTTTGGAGGATGTCGCCTTCTTCGTGTCGCGTCAG
TCAAGCATCGCCAGCGAGTCCGATCTGTTGCGCGGGGTCGTTTCGGCTTCCGTGCTGGCCGCGGAGGAGGGGCAA
CAACCACGTTGCGTTTTCCGCGAAGACAGTGAACAACACGCAGATGAGGGAGAGGTACAGTTTTCTCTGGACTTG
GGCTTGTATGTCGGTCCTGAAAATGGCGAGCAACAACCCCTTGTTGGAGTTCGAGACAGTGCCTTCACGACATTC
ATTCGACCTACCACCACGAAAGATACCCTCGAAATCAGTTTTGCCTATCCGACACGCCTTATACCTGAGCCGGCA
GTGGATCAGCTACTCAGAATTCTTGCCACACAACTGGCAGACTCAACCACTTTCCTTACCTTTGACGCTCCGTCG
CCCAATCTTTCAGTCTTGAATTTTCCTCCCCTTATGATACCCCCTTTGCGAGAGACGGACCAAGTTGATTTTCCC
GAGTCTGGCCATTCCAAACAATATCTTCTCCATGTCGCTTTCGAGGGCTGGGCCCGTCGAAAACCTGATGCCATA
GCGCTGGATTTTGTTCATTCTTTGCCTTCTGCCACGGCTGCGGCAGAACACAGCCTTCTTACTTATGCCGCACTT
AATCAAGCAGCCACTATCCTCGCTGTACATATTCGAGCCCTTTTGTTGGCGAAGAACGCCGCCGACTATGGACGC
ATCATCCCTGTTTACATGCCATCGTGTCCGGAACTTTACATTACATATCTCGCCGTTCTCAAGGCTGGTTTCGCT
TTCTCTCCGATACCCCAGGATGCACCGGTACAACGGGTTCGTGATGTCCTAGAAGACATCGACTGTCCGATTATA
CTTGGCAATACCCCAGAGCCCGTCTCTGGGCCATGGTGCGATGCTAGCGCCGGTTCAACCATCAAGCAGGTTTGG
GTTGACGTAGCGGAGGCCTCAAGATGGAAGAGCTTGCGTGATGGTCAGTCCGAGTCCTCGGAGCACGGCGAGCCT
CTGGAACAGTTAGACATCGAGCATGACCAAACTGCGTACCTCCTATTCACCAGCGGCTCTACTGGAAAGCCAAAG
GGTGTTCAGATCAGTCACCTAGCTGCCGCCTGCTCCATTGAAGCTCATGCTACAGAAGTTCCTATTCCGGGAGAA
GAAATTGACGATTTCCGCTGGTTTCAATTCTGTGCTCCAACCTTTGACCCTTCCCTAGCGGAGATATTTGTAACC
TTGGGTTGCGGTGCCACTCTCTGCTCGGCCGACCGCAGCTTGACGCTAACCGACCTGGAAGCGACCATCAACGAA
GCTAGAGCAACTGTGATGATGGCTACGCCTAGCTTGGCTGCCCTTCTTCGGCCGGAACGGCTAACCACGCTCCAA
TACCTCTGGTGTATCGGTGAAAAGCTTAATAGAACCGTCATCGAAAACTTCTCCGCAAAACCTGGTACAAATGGA
GGGATTACTGTATCCGAGCCCTCGCGGATGTTGGTCAATACCTACGGTCCGACTGAAGCAACGATTGCCTGTACT
TACCTGGCACCATTTGGCCATTCCCTCCGCTGCTCCATAATTGGCCAAGCGCTAGCAACCTGTTCAATGTTTGTT
CTCGACCCCAACAGCCGTGAGCCTCGAGCGGTTCCTGCTGGTCTTGCCGGTGAACTAGCAATTGGTGGCCCGCAG
CTCAGCAAAGGTTATCTCAACCGTCCGGTAGAAACTGCAAAGGCGTTCGTTGATAGTGGCGAGTTCGGTCGCTTG
TACCGGACTGGTGACATGGCACGGATGGTTTGGGACGAATCTGGTTCCCAGATCATTGAATTCCTTGGTCGTATC
ACGTCTGACCAAGTCAAAATTAGCGGTCGGCGACTCGAACTAGGCGAGATCGAATCAGTCCTCGAGACTGTACGC
GGTGCCAACGAGGTTGTAGCCGTGGTTTCCAAACGCGATGCTAATGTCCAGGGAAGTGAACAGATCGTCGCATGC
CTCGTTGCAAATGGCAGCATTGAAGCGGAGAGAGAGGATATTATCTGGGAGGCACATCATAATTCCGAGAAACAT
CTCTCTTCTTACATGTGTCCGTCTGCTTACGTTTTTCTCGATGCTCTCCCTCGGTCCAGTGCCGGGAAAGTCGAT
CGCAAAGCGGTAACTGCAAGGCTGCAGCAGGGTTCGGGGGGCGATATCAGACTATATCCTGCACCCAAATTGAAG
CCTGCGGAAACGAATGGGATTCATGATGACTGGAATTTCCTTATTGATGAAGACTTGCTGTCCATTCAGCAGCTT
ATAGTTGGCCTCATTGCAGAGGCAACGGATGAGAGTGTTTCTGCCATCAAGCCTGGGACCGACCTGTATTCACTG
GGTATCGATAGTCTGGGTGCAATGCGGCTTCTGCAGAAGCTTAGGGACCATTCTATAGAAGGTTTATCGGTTGGT
GACGTTCTACAGTCTGGAACCCCCAAAGCATTGGTCAACGCCGTCGCTCAGCAACGTCAATCAAACGGTATCCCC
CAGGTCAATGGCTCGGATGAGACCCTCCAACACAGTCTTTCAGCCTTTCAAGATCGGAATCACACAATTTGCGCT
GAGAGACTGGGCATGACTCCTGAGAAGATCCAAAAGGTGCTTCCAACAACCGCGACACAGTCTGGCATATTGACT
AGTTTCCTGCGCAGCTCATCTGACGCAGCCTTTGCGACTCGCTCATACATCTATCATTCTGTTTTACCACTCGAA
CCGGGAGTGGACATAGATCGTATCAAAGCTGCGTGGGAAACCGTCATTGCAAGCTACGACTCCTTCCGGACAGTT
TTCTGCTGGCTTGATGACGATATGGCACCATTTGCTCAGTGCATCCTCGCTCCCACAGCAGTCTCAGGGACGAGG
TGGAATACCTATCATTCCACGAAGCAGTCTTCAGACGAAAACGTGTTGCAGCAGGCCCTCCAAGAAGCAGAGGAG
TCAATTGAGCTAGGCACACCACCTTGGAGGTTATCACTGGTAACATCTCCGGCATCTACTCGAATAATCTTGAGC
ATGTTTCATGGTATTTTCGATGGCGGATCATTACAGCTCTTGCTCGAGGACGTGTCTTGTGTGTACTCGGGGAAC
ACGCCAGCACAGCGCGTTTCTCTCGAGCATCTTGTGAAGCATCATTTCCAGGCTGACCATGCAGCAACCGCCAAA
TTCTGGGGGGAGCATCTGGAAAGCTATTCTCCTGTCTGGTTCCCATCTGTCACGCCTTACCGTACCCCACCAACA
AAGAAAACTGGATGTGTGGAAATCACGGCTCGCACAAGCTACGACCGCTTGAAACGAGAGTCTAAGCTCATCGGC
TCAACACCGCTTTCAGTGCTCCAAGCAGCTTGGGGGTCGGTCCTCCTGGCTTACACTGGAACTCCAGCTCAGGAC
GTAGTTATGGGCAGTGTCGTATCTGGTAGGCTTGACGTGGACTCAGAAGCCTGCGTTGGTCCGACATTTACCACT
GTCCCGATCAGGCTTTCCCTGAGCCAAATCCAACAAGACTCCCAGAAGTCGTGGACAAACCGCTCGGTCGCGCGC
CATCTGACAACTTTTAATGCACAGACACTATCTCACCTACAACCTCGGCTAGGATCGCTAGTAACGGCGGATGGC
CGGCTTCCATACGATACCCTCATCGCCTACCAAGACTTCAACGCTGGCTCCAGTGTTAGTGGTCTCTGGAGCTCA
GTCGACCATCCGGCCATGGCGAACGATTTTGCTGTTATGATCGAGATATGGCCCGCTGCTAATTCATCTCTGACA
TTCCGGGCTAGTTTCAACGACGCTCTGCTTGATCGTAACTCCGCCGAAATGATGCTCTGGCAGATGTCTGACATT
GTCGCTTACATACTAGAGCAGCCCGATGAGAGCTTCCAAGATGCCCCATCTCATACGGAGACTGGGCTAAAGTCG
AGCTTCAACTCCAAGCCGTCTATCGCTCCCGAAGTACTAGACGGTGCACTTCTTCATTCCCAGTTCGAGGAGCAT
GCAGCGTCCCATCCAGAAGATCCTGCCTTGATCTTCAGGTACGACTTAGATGACGAGAGCAACCCACGAAATATC
ACGTGGTCCTACGCCGGGCTCAACGCTTTGGCCGACAAACTCGCAGAGCATCTGCTTCAGACTGGCGCACGAGTG
GCAAACTCGCCGATACCTATTTGTATCGAGAAGAGCCCGGCCTTGTATGTTGCCATTCTTGGCATTCTCAAAGCT
GGTGGTGCTTGGTGCCCGATTGATACGCTCTCTCCTGCACAACGTCGCCACGACCTCATTGCACGGACCGGTTCA
ACAATCCTTCTGGTCTCTAGTGTAGATGGAGAGCAGCCAGATGGTTCAATTCCCATTGGTGTCGAGACAATTGAC
GTTGGCAAATTCACCATCGACGAACCCATCTATGCGAACGGAGTGGTACGGGGCGCGTCTAGGGACCGGGCTACT
CCTGATGGCATGGCGTATCTCATCTGGACGAGCGGTACAACAGGAGCACCGAAAGGTGTCCCGATCAAGCATTCT
TCGGCTGTCTCGAGTATGAAATCACTTCAGAAGGATATCCCTACTGATGTAGCTGGCGGGGACATCTTCTACACC
TGGGGTGTGGGGGGCGTTCTTATCTCTGCATCGAGAGAGATCATGCTTGGTTCGTTCTCAAAGCTTGCGAACACC
ACGAATGCCACACACGCACACCTGACTCCAGCCTTCTCGGCAGGTGTCTCCCGAAAATCATGCCCGACACTTCAA
GTAATCACTATGATCGGTGAGAAGCTGACGCAACCTGTGGCCGATGACTGGGGTACCGATATGAGAGCATTCAAT
ACTTACGGGCCCGCCGAAGTGACAGTGGTTTCCACGATCAGGGAGTTTGGTAACGAACACAAAAACATCAAGAGC
GCGAACATTGGCTGGCCTATGGATACTGTGTCTGTGTTTGTAACAAACAAGCAGCGGCTCATCATGAAGAATGCT
ATAGGCGAGCTGGCGCTGGGCGGACCACAACTTTCTCCTGGTTATCTGAATCAAGAGGATGTCACCAAGGCCAAG
TATGTCTGGAACGAAGAGGTTGGTCAGATGGTGTACTACACTGGAGATTTGGTTCGCATGCTTGCTGACGGATCC
CTGGAGTACATCAATCGTGTTGATGACTTGGTCAAACTGGGAGGTATCAGAGTGGAGCTGAGCGAGATCAGCTTC
TCGCTCGGCGAGTGCCATCCTCTGGTTGAGAATATTGAGACGCTTATTCTCAACCGCCCAGACCGGCCTAACAAG
GTTGTGGTCGCCTTCCTCTCTGCTTCGAAAGCTACACGCACCGAAGACGAGCAGCTCTTGATGATCGATAAGGCG
GCGCTTGAGATTGCCCGTGCTGCCAGCGAGAAAGCACAAAGCGTTCTACCTGACCACATGATACCGTCTGTATAC
CTTGTGGTCTCGCACATCCCGAGAACATCATCCGCCAAGACAGATCGCAGGGCCTTGGAAGCTGCCTATGCCGGT
GTGGATATCGATAGTTGGGAGAAAGAGATGAATCCAGAAATCAAATCTTCTGCAGCGGACTCCCAGGACCAGCAC
ACCGCGACCATAACACACCGGGTAGTAGAAATGATTTCTACCTTGGCCAATATCTCCCAGTCAATTATCACGAAG
TCCAGCCGCCTGGGGAGTCTGGGTATCGACTCTATTCGCGCAATCCGGCTTGCCTCTAGACTCAAGGAGGCCGGT
CATCAATTGTCTGTTGTGGAGGTCCTAAATTGTGTGACTGTCCAGGATCTTGTCCAACTGGCCTCGTCATCTACT
GTAGTGGAGAAGCCCACCTTCGAAACGTTCGACGTTAGGGCATTCCATGACACCTGGCACACAGCCACAGTCAGC
AAAGTACCGGAGGGATTCATAACTGTGCGCGCGACCACGATCCAGGAAAGTCTTCTTAGTGAGACAATGGGTACA
TACAACAGATATTGGAGTAATCATTTCTTTCTGCTTGACAGCTCGGTGGATGCGACGCGAATGAAACAGGCTTGG
CTTGCAACGAGCCAGAAGGTGGAGGCTCTGAGAACTGGCTTTATCCCTGTTGCGGAGGTCGATGACGGGAAAAGC
CGATCGCAAGGAAAACTTGACTTTTCTATATTGCAAATCATTTACACGCTACCAGATGTTGATTGGGAATACATC
AACTGTTCAGAGCAGGATCTGGTGGAGCATCGCGAAAATCGGATTGAGGAGATCATGACCAAACACCAGAAGAAC
TATTTTAAATATCCCCCATGGGCCGTTACAGTATTCGACACAGGCAAAAGGCAGCTCATGATCCTCACCCTCCAT
CATTCGATTCATGACGAACCTTCCCTGGGACTTATAATGGATGATGTGCGATCAGCTTATGCTTATAAACCTCCT
CAAAGACATCAACTCAGTGATGCGCTCTCGATCGTTCTACCAGGAGAAAATCGGAGCAAGGAGACCAGAAGCTTT
TGGAAAACCGAACTCAAGAAATTTGCAGAGCTTGATGCGCCAGTGTGGCCCGATCTCACTGGGAAGAGGTTGCAG
CCAGGCGAAGTCCCCAAGCATATCTTGATTACAGAAGAGTCGCCTTTAACGGAGCCTGTTGACAACCTGCAGTCG
TTTGCAGCCCAACTTGGGGTCTCATCCATTGCCTTGATTATCCGAGCCGCATGGGCCTATGTTTCGCTGGCTTAT
CTCGGTCTTCCAGCGACAGTCTTTGCTGAGACTCTCTCTGACAGAGTTCTGCATGCTGACCTTGAAGACTGCATT
GGACCCCTCATCTCCGTTGTACCTATTCCGTTCCATCCAACGGGAAACACTCGTGAGCTACTTACCAAGCAGCAT
CGCATCTCTGTTCAGTCCTGGAAGTATCGCCATATCCATGCTCGCGAGGTCCGAAAGATTCTCAAGAGACCCAGG
GGTGAGGCCTTATATCCGGCGGTGTTCAACTTCCACGTCGCGAAAGAAGAGGGTGCAAACGTCACTCAGCCTAGC
ATCTGGCGCGAACTCGAAGATGAGGTCGGGCTGCATGTTGAGCATCCCATGGCCATGAACGTTTTCCAACATATG
GATGGCTCTATAGTCCTCGAGGCAACTGCGGACAGCAGCATAATGTGTCGGGCACAGCTGTCACTATTCATTCGT
CAGATTGACGGGCTTATCAGTTCAATGCTCGCATCTCCAGACCAGCCCCTTGCAAGTCTAATCAACCGCTTTCCT
TCGCCATTACGATCGCTATCGAATCAGCCTGTCAGAGAAGAAGTAGTGAAGTCTGTTCGACTGAGCCCTACGCAC
TGGTTAGAGGTGTATGCGAAGAACCACCCTGAATGGACAGCCGTTGAGGTAGCCAGTGAAATTTCCTCAAACGGG
ATTGTGAAGGAAGCTATGACCTTCGGTACATTAAACTCTGAAGCAAACCGTGTTGCGGCCTACCTGGCATCTCTT
GGTCATAAGAACAGGATGATCGGAGTCTGTATTGGGCGAAACCTGCCCTCTTATCCCATCATAATCGGTATCTTC
AAGTCAGGAAATGCTTACCTTCCAATCGAAGAAAACCTTCCGGAGGATCGCAAAGCTTTTCTCATCAAGGATAGT
GATTGTCCTATTGTTTTCACCGAAACGGCGTTCGTGAGCACGTTCCAAAGTACCCCCGAGGGATGTCGCGTGATA
ACCATCGACAACTCGGAGCTCTTGGGCTCACTTGCCACCATGCCAACAGAAGATCAAGACTATAACTCCGATCCC
AACGATCTGGCATATCTTTTATTTACCTCAGGCTCGACAGGAAAACCGAAGGGTGTGATGGTGACCCGAGGCAAC
CTTTCATCTTTCATCGAGTCGATCTCGGTGTTCACAGGCCGGTATGCCCCCGCTACGTATGATCTGGGCGGCACT
GGAAGATATCTCGCGCAGGCCAGTCGAGCTTTTGATCCCCATCTGTTGGAAATGCTCTTCCCATGGCGCCATGGG
ATGGCTACTGTTACAGCTCCTAGGATGATGATTTTGGATGACCTTGGGATAACCTTGTCCAAGTGGGATATCACT
CATGCAAGTCTGGTGCCATCTCTTCTGGATCAAGCAAATATTGTACCAGAGCAATGTCCCAAGTTGAGATTCATG
ACTGTTGGTGGAGAAAAGATTTCACAGAAGGTATTGGACACCTGGGCGGGAACACCAAACATGGCGCTTATCAAC
GCATACGGCCCGACAGAGGTAACCATCGGCTGCACATTCGCTCCTGTCGGAAAAGACACAAACTTGCGCAATATC
GGACCTCCCCTAGCAGCCTGTGTGTCTCATGTCCTTGTCCCTGGTACCCTTAACTATGCTCTGAGAGGCCAGGCT
GGCGAGCTATGCTTTTCTGGAGACCTCGTTGGAAGGGGCTATCTCAACAGACCAGATGCCACTGGCTTCATCACC
GGACCTAATGGTGAAAAAATGTACCGGACTGGTGATTTGGGACGCATGATGCCAGACGACTCGGTCGAGTATCTT
GGGCGTGGCGATGACCAGACCAAGATTCGTGGTCAAAGGCTAGAGCTCGGTGAGGTATCTGAGGTGCTTCGCTCT
TCGTCGACTGTTGGCGTTGATGTTGTCACGACCGTGGCCAAACACCCTGGTCTTTCAAGAGTTCAACTTATCTCG
TTCATCGCGCGGTCGGAAGCCCGTCAACGTGTGAAGAGCGGGGATGTCACCTTCGTTATGTCCGACTTCGCAACG
CTAGGCAAGGAACTTCGAGACTCTTGCAAGAGGAAGCTACCGGGCTACATGGTTCCCGAGCTTATTCTCCCCATC
ACTTATATACCTTTGGCACCGATGTCAGGAAAGGCAAACATCAAAGAGCTACATGGCCTCTTCTCCAGCCTTCCT
CTGCCTACTGTCCTTCAAGGTAACAGCTCGGCAAGTAAGGACGGCGTCGTTATTGAACGGTCTTTGACTGCCGAC
GAAGAAGCTGTGATAAAAGAAGTCCTTGATGTTGTTTCGGCGGATCCTTCGATTGTTGGACCCATGACGAACATC
TTCGAAATTGGCCTCGATAGTCTAAGTGCCATAGGGCTTACGATTAAGCTCCGGAGAATTGGGTATGAAGTCACG
GTAGCCATGGTCATGAGCAACCCGATCATTGAGCAGCTTGCACGCTTACCTAGGGGTTCTTCGGACGCAGAGAGT
GCTGTCTCGCAGACACGTCAAGCCTTTCAAAACATTGAGTCTCAATACCGCCAACAACCGTCGCCCGGTGTCAAC
CCGTCCGATGTGGACACGGTCAGGCCTTGCTTGCCACTTCAGGAAGGTTTGGTTGCTCGCTCAATAAATAGTGAA
AGCGATCAACTCTATGTCAATCACATTGCCCTTAAACTCGAGGCCTGTGTCGATAGTGAGAGGTTAAAATCTGCC
TGGCAAGCCGTCTCCAATGACACCGAAATCCTGAGAACTTCATTCGCTCCTTTGGACAAGCAAATGGTGCAAGTG
GTCTACACGGTCGATTCTCATCAGTTTCCATGGAAGGAAGAGGAGTATGAGAGCCTGAACGAAGCTATTGAGCAT
AACAAGGCACAACAGAAGCAGATCTCTGAGGATATCATTGCAAACATCTCCACTGTCCCACCAGTGCGGTTCCTC
ATAGCCAAATCCTCCGAAACCAAGGAACCGCTTGCCCTCTTCATTAACATTCATCATGCACTCTATGATGGAGAA
TCTTTCACGATGATAATGGAGGATGTGGCAGCGCGCTATGCAGACCAACCTATCCTTCAGAGAGGCTCGCCGGCG
GCTTTCGTTGAATATGTTTATAGTCAGGATTCAGAAAAGGCCAAGCAACACTGGGTCCGCTATCTGGAGGGATGC
CATCCGACAACTTTCCGTACTGACTTCAATGCCATGGAGCCTCCGGTCGTCGTACATAGAAGCCTTGGTGTGAAG
CTTTCTGAACTGGAGCACCGCTCTGCAGCTCTTCAGACCACTGTACCATCCTTGGTGCAAGCGATTTTCGCACTC
TTGCTGGCTGATACCGTTGGTGTGTCAGATTTGACCTATGGGTTGGTCCTGTCCGGTAGAGCCGTGTCGGTTCCC
GGAGCCTCCTCGGTACTTCTGCCTTGCATCACTACTGTCCCTGGTCGTCTCAATACCGCTAGCCTGGGTACAGTT
GACGATGTTGTGGCGGATGTCCAAAAGTCTACGGTGGGGTCGCTTGATTTCCAGCACACACCCCTAAGACATATA
CAGAGATGGATTAATGCGGAGACACCTCTGTTCGACTGTCTATTTTCATATATTAGGACTGCTGCGCCACCAGAA
CACCGCCTGTGGCAGGAACTAAACAGCAATATGCCTGCCGAGTATCCGTTGGCAGTGGAGGTCGAGGCCAACCAT
TCCATGGACACTGTTCAGCTCAACTGCTTCTTTTCATCTGCTTTCGGCTCCCTATACAGTGGAAGTGAATTGATC
GAGAAGATGGACGCAGTGCTCTCGAGCATTGCAGCAGGTCAAAGTCTTTCGCTAGACGACTTCAATGTCTCTCAT
TCAGCAGCATCTGGTTCGCGTCCTGCTGTGCTGTGGGACAACACCACATGGTCCACCGCGGAAACCACGATTCGT
GAATACACGATGTCTTTTTGCGGATTGACTTCGGCCGAAGTCACTAAAGGCGCTTCTTTCTTGAGTTTGGGTGTT
GATTCGGTCACGGCAATTCAATTTGCGCGTCAGCTACGGGAAGCTGGGCTTCAGGTTTCTTCTGCTGATATTATG
CGTTTCTCATGCGTTGGTGCGTTGGCCCAGCATGTGGAGCAGAAAACACGTTCTCAGACCCCGGTTAACGGTACC
AATGGGCACGAGAAGACGATTACCGGTATCCCTATTGAGACCTACGGCGAAAATGTCCGACTCCTTGCAGAGGAT
GACTCGATCTCTACAATGTTCGAAACTACGCCCCTGCAGTCGGGAATGATTACGCAGACAATTGCTTCTAGCGGA
AAGGTGTACGCTCACCCGCACATTATCAGATTAAAAGACTCGGTCGATACTACCCGACTGAAGGAGGCTCTTTTC
AGAGTCATCGATGCAAATGATATTCTGCGGACATCCTTCCACCTGATCGCTGAGCTTGGTTCCTCCTGGATTGCC
GCCGTACACACCAATCCCCCTTTCCAGTGGGAGGAGCTCACATTGCCTTCCGGGGCCGATGTTCTGACTGAAGTC
GACTCTCTTTATGATTTCAGCGAAGAGGCTTCTTTCGAGGTCCCACCTATTCGGTCTGCTCTAGTCAACCAGCCT
GAAGGCAAATTACTGGTTGTTGTTCTGCATCATGCTCTGTATGATGGTTCTTCCATCCCCTTCCTGTTTGAGGAC
CTGGCCGTGTGCTATGAAGAAAGCAGTCTTCCGATAAGACCACAGTTCTCAGAGACTGTCCAGCATCTACTAAGC
GGTCAAGAAAAAGCTTGCGAATTCTGGACAGAAAGACTACTCGGATATGAAGCCACTGAACTTCCTGAGCTTCCT
CATCCTGAGTCGTCAGACCGCATGTTGCTTTCTGAATGCCGGGTTGACCTTGACTTGTCGGCCATAGTGGATGCC
TGCAAGGCAATGGAGGTCACCGTGCAGAGTGTATCTCTCCTGGCCTATGCGAAGGTTCTAGCAGGTGTGGTCGGA
AAACGTGATGTCGTCTTTGGACAAGTCCTTGCAGGCCGCTCGTTGCCTGTTGCTGGTGCCGAACGAACCCTCGGG
CCAATGTTCAATACAGTTGCTCAGAGGGTCTCTTTCGAGCCCAAGTTCCTGAGTAACAAGGCCATGGCCCAGCGC
TTACAACAGCATACAATTGATTCGCAGAGCCATCAGAACGCGCCACTCCGACTTGTGCAGAATTCTTTCAGGCAG
GCTAACAACAGCATATCATCCATGCTTTTCGATACTCTCTTCGTCTTCCAAAAGAGTGCGGACTTCGCTGGCAGT
ATCATAGAAGAGCAACAGATTTGGACACCTTATGAAGCAGATGACTATGCCGCGCAGGCAGAATATAAGCTCAAT
GTTGAGGTCGATCATGCTTGCGATGGACTTGTGGTACAAGCAACTTGCAACGGCCGGTACATCTCCCAGGAAACG
CTTGACCAACTGATGGATGAATTCGCCATTGCGTTCCGTGACATTATCGAGCATCCTACTAGATGCGCTACCATC
GTGCCACAAGGACTTGGTGAGTTACCGACAAAGCTGTCTGTTGAGCAGTCGCTCGACCCCGATGTTGAATCATCC
GAAGTACCATCCCATGAGGCCATCATCCAGTCTGTGCTCGCTGAGATTGCCGGAATTCCTGTGGACAACATCAAA
CCAAACACTAGCATCTTCAATATCGGGCTAGACTCTCTCACAGCTATCCGCATTGCTTCGATTTGCCGATCGAAG
GGTTTGAAAATCGGGGTAGCCGACATCCTTCAGGGGAACACCCTGCGTGGGATCAGCCAACGCATCCAGCCATTG
TCCGAACAGGCAATCCAACCTCGGGGTTCATTTATCAAAAATTACACCGAGGTGGAAACCACTGTGCTCCAACAG
CTCAACCTCAGCAAGGACTCTATCGAAGCCATTCTACCTTGTCTCGGTGGCCAATTCTATCATTTAGTCAGCTGG
TTGAAATCTGGACGGAAGCTGCTCGAACCTGCCTGGGCATATGCCTGCTCCGGGCGCATCGACAGTACTAAAATT
GAGGAAGCTTGGTTCCAGCTCCGCCAAAGGCATCCTATCCTCCGCACCTGCTTTGCAGCTATATCCTCGTCGGAA
GCGGTACAGGTTGTTCACAAACAGGCAATGCGTGGTGCGGGCACATTCCAGGTTATCGAGACCGCTACACCTCTT
TCTGAAGCAGCCCAAGCACAAGCAAGAGAAGAGGCTCTCCATCCATCCTCGCTTTTTACACCTCCCGTCAGACTT
CGTCTATTGAAAGCTAGCGACAACGATGGTATTCTCCTCCTCATAAACCACGCCGCGTATGACGCATGGACCATG
CCAATGTTCGTTAAAGAGCTAGCAGAGCTCTACAATGGCCAACGCCCCGCAACTAACACTGACTTCCCTGCATTC
GTCGACTTCTCAATGTGCTCTCTCCAGAGCCTCGATGAAAAGCAATACTGGAACACTACTCTCGGTGACGCCTCT
CCTACCATCATCCGCAACACTCGCACCGAAACCCAGCCTACCCCAGACCAGCTCTTCATCGGAGTCTGGGAAAAG
GTCAAGGACCTCTCCCAACTCGAGACAAAATGCCGATCCTCCAACGTCAGTCTACAAACCGTGGTCCTCTTCGCC
ATAGCCCGCTGCATCGCACGTCTTACCGACGTCCAAAACCCAACAATGGGTCTCTACCAAGCCGGTCGCTCTGCC
TCCTTCAACAACGTCGAGAACCTCTCCGGACCCTGTCTGAACGTTAACCCATTCACCATCCCTAATGCAGACACC
AACCCCATCGACACTGATCTTCTTACTCAAGTTCGTGCTATCCAATCCTCTCTCGCGGACCGCGTCTCCTACGAA
CAAAGTTCCCTCCGCAACATCCTCCAGTGGATCTCACCCGAGAAACCCCTCTTCAACACCTGGGTGAATCTCCTC
TGGACACAGAACACTATCTCCTCGAATGCCAATTCCACATCAGATGGTACTGAGGACTTCTTCTCCCCGTTGCGG
ATCGGTGTCCCTACAGACTTCATCCCCGAACAGCCTTTGGCTGAAGAAGTCACTGCCGTGTCGGCACTAGATACG
GAATTCCTGCCGTCAGAAAATGTGTTCATTGATGTTGGTCCAGATGCCAAGACGGATTCTATCGGGTTTGGTGTT
CGAGTTGAAGGGGGAGTCATGAGTGTCGAGGAGGTGCATAAGCTTGTTGATGAAATTACGGGAGAGATTGAGAGA
ATTATGGGGATGTTGGCATGA
Gene >Ani_SJS72_1|g361.t1
ATGGCTGCTCCAGTCGTCCCTGTCACCAGAGTTCCTGCCCTGGACACGCTCGATCAATATGTTGTGGGAAAAGCC
GCGGCCGATAAGGCGGCGATCAGCCCATCCGTCGAGCTTACCTGCAGCTCCGACTACTGCGACATCGCAAATAGC
CTGATCGAAGGCTACGCCCGTTTTATCTCTCGTCTAACTGGTTTGGAGGATGTCGCCTTCTTCGTGTCGCGTCAG
TCAAGCATCGCCAGCGAGTCCGATCTGTTGCGCGGGGTCGTTTCGGCTTCCGTGCTGGCCGCGGAGGAGGGGCAA
CAACCACGTTGCGTTTTCCGCGAAGACAGTGAACAACACGCAGATGAGGGAGAGGTACAGTTTTCTCTGGACTTG
GGCTTGTATGTCGGTCCTGAAAATGGCGAGCAACAACCCCTTGTTGGAGTTCGAGACAGTGTAAGTGTTCTGCCC
GCGCAGGAACGCGGAGGCTGCCCAATCTGACTAACGTGCTGCTGCTAGGCCTTCACGACATTCATTCGACCTACC
ACCACGAAAGATACCCTCGAAATCAGTTTTGCCTATCCGACACGCCTTATACCTGAGCCGGCAGTGGATCAGCTA
CTCAGAATTCTTGCCACACAACTGGCAGACTCAACCACTTTCCTTACCTTTGACGCTCCGTCGCCCAATCTTTCA
GTCTTGAATTTTCCTCCCCTTATGATACCCCCTTTGCGAGAGACGGACCAAGTTGATTTTCCCGAGTCTGGCCAT
TCCAAACAATATCTTCTCCATGTCGCTTTCGAGGGCTGGGCCCGTCGAAAACCTGATGCCATAGCGCTGGATTTT
GTTCATTCTTTGCCTTCTGCCACGGCTGCGGCAGAACACAGCCTTCTTACTTATGCCGCACTTAATCAAGCAGCC
ACTATCCTCGCTGTACATATTCGAGCCCTTTTGTTGGCGAAGAACGCCGCCGACTATGGACGCATCATCCCTGTT
TACATGCCATCGTGTCCGGAACTTTACATTACATATCTCGCCGTTCTCAAGGCTGGTTTCGCTTTCTCTCCGATA
CCCCAGGATGCACCGGTACAACGGGTTCGTGATGTCCTAGAAGACATCGACTGTCCGATTATACTTGGCAATACC
CCAGAGCCCGTCTCTGGGCCATGGTGCGATGCTAGCGCCGGTTCAACCATCAAGCAGGTTTGGGTTGACGTAGCG
GAGGCCTCAAGATGGAAGAGCTTGCGTGATGGTCAGTCCGAGTCCTCGGAGCACGGCGAGCCTCTGGAACAGTTA
GACATCGAGCATGACCAAACTGCGTACCTCCTATTCACCAGCGGCTCTACTGGAAAGCCAAAGGGTGTTCAGATC
AGTCACCTAGCTGCCGCCTGCTCCATTGAAGCTCATGCTACAGAAGTTCCTATTCCGGGAGAAGAAATTGACGAT
TTCCGCTGGTTTCAATTCTGTGCTCCAACCTTTGACCCTTCCCTAGCGGAGATATTTGTAACCTTGGGTTGCGGT
GCCACTCTCTGCTCGGCCGACCGCAGCTTGACGCTAACCGACCTGGAAGCGACCATCAACGAAGCTAGAGCAACT
GTGATGATGGCTACGCCTAGCTTGGCTGCCCTTCTTCGGCCGGAACGGCTAACCACGCTCCAATACCTCTGGTGT
ATCGGTGAAAAGCTTAATAGAACCGTCATCGAAAACTTCTCCGCAAAACCTGGTACAAATGGAGGGATTACTGTA
TCCGAGCCCTCGCGGATGTTGGTCAATACCTACGGTCCGACTGAAGCAACGATTGCCTGTACTTACCTGGCACCA
TTTGGCCATTCCCTCCGCTGCTCCATAATTGGCCAAGCGCTAGCAACCTGTTCAATGTTTGTTCTCGACCCCAAC
AGCCGTGAGCCTCGAGCGGTTCCTGCTGGTCTTGCCGGTGAACTAGCAATTGGTGGCCCGCAGCTCAGCAAAGGT
TATCTCAACCGTCCGGTAGAAACTGCAAAGGCGTTCGTTGATAGTGGCGAGTTCGGTCGCTTGTACCGGACTGGT
GACATGGCACGGATGGTTTGGGACGAATCTGGTTCCCAGATCATTGAATTCCTTGGTCGTATCACGTCTGACCAA
GTCAAAATTAGCGGTCGGCGACTCGAACTAGGCGAGATCGAATCAGTCCTCGAGACTGTACGCGGTGCCAACGAG
GTTGTAGCCGTGGTTTCCAAACGCGATGCTAATGTCCAGGGAAGTGAACAGATCGTCGCATGCCTCGTTGCAAAT
GGCAGCATTGAAGCGGAGAGAGAGGATATTATCTGGGAGGCACATCATAATTCCGAGAAACATCTCTCTTCTTAC
ATGTGTCCGTCTGCTTACGTTTTTCTCGATGCTCTCCCTCGGTCCAGTGCCGGGAAAGTCGATCGCAAAGCGGTA
ACTGCAAGGCTGCAGCAGGGTTCGGGGGGCGATATCAGACTATATCCTGCACCCAAATTGAAGCCTGCGGAAACG
AATGGGATTCATGATGACTGGAATTTCCTTATTGATGAAGACTTGCTGTCCATTCAGCAGCTTATAGTTGGCCTC
ATTGCAGAGGCAACGGATGAGAGTGTTTCTGCCATCAAGCCTGGGACCGACCTGTATTCACTGGGTATCGATAGT
CTGGGTGCAATGCGGCTTCTGCAGAAGCTTAGGGACCATTCTATAGAAGGTTTATCGGTTGGTGACGTTCTACAG
TCTGGAACCCCCAAAGCATTGGTCAACGCCGTCGCTCAGCAACGTCAATCAAACGGTATCCCCCAGGTCAATGGC
TCGGATGAGACCCTCCAACACAGTCTTTCAGCCTTTCAAGATCGGAATCACACAATTTGCGCTGAGAGACTGGGC
ATGACTCCTGAGAAGATCCAAAAGGTGCTTCCAACAACCGCGACACAGTCTGGCATATTGACTAGTTTCCTGCGC
AGCTCATCTGACGCAGCCTTTGCGACTCGCTCATACATCTATCATTCTGTTTTACCACTCGAACCGGGAGTGGAC
ATAGATCGTATCAAAGCTGCGTGGGAAACCGTCATTGCAAGCTACGACTCCTTCCGGACAGTTTTCTGCTGGCTT
GATGACGATATGGCACCATTTGCTCAGTGCATCCTCGCTCCCACAGCAGTCTCAGGGACGAGGTGGAATACCTAT
CATTCCACGAAGCAGTCTTCAGACGAAAACGTGTTGCAGCAGGCCCTCCAAGAAGCAGAGGAGTCAATTGAGCTA
GGCACACCACCTTGGAGGTTATCACTGGTAACATCTCCGGCATCTACTCGAATAATCTTGAGCATGTTTCATGGT
ATTTTCGATGGCGGATCATTACAGCTCTTGCTCGAGGACGTGTCTTGTGTGTACTCGGGGAACACGCCAGCACAG
CGCGTTTCTCTCGAGCATCTTGTGAAGCATCATTTCCAGGCTGACCATGCAGCAACCGCCAAATTCTGGGGGGAG
CATCTGGAAAGCTATTCTCCTGTCTGGTTCCCATCTGTCACGCCTTACCGTACCCCACCAACAAAGAAAACTGGA
TGTGTGGAAATCACGGCTCGCACAAGCTACGACCGCTTGAAACGAGAGTCTAAGCTCATCGGCTCAACACCGCTT
TCAGTGCTCCAAGCAGCTTGGGGGTCGGTCCTCCTGGCTTACACTGGAACTCCAGCTCAGGACGTAGTTATGGGC
AGTGTCGTATCTGGTAGGCTTGACGTGGACTCAGAAGCCTGCGTTGGTCCGACATTTACCACTGTCCCGATCAGG
CTTTCCCTGAGCCAAATCCAACAAGACTCCCAGAAGTCGTGGACAAACCGCTCGGTCGCGCGCCATCTGACAACT
TTTAATGCACAGACACTATCTCACCTACAACCTCGGCTAGGATCGCTAGTAACGGCGGATGGCCGGCTTCCATAC
GATACCCTCATCGCCTACCAAGACTTCAACGCTGGCTCCAGTGTTAGTGGTCTCTGGAGCTCAGTCGACCATCCG
GCCATGGCGAACGATTTTGCTGTTATGATCGAGATATGGCCCGCTGCTAATTCATCTCTGACATTCCGGGCTAGT
TTCAACGACGCTCTGCTTGATCGTAACTCCGCCGAAATGATGCTCTGGCAGATGTCTGACATTGTCGCTTACATA
CTAGAGCAGCCCGATGAGAGCTTCCAAGATGCCCCATCTCATACGGAGACTGGGCTAAAGTCGAGCTTCAACTCC
AAGCCGTCTATCGCTCCCGAAGTACTAGACGGTGCACTTCTTCATTCCCAGTTCGAGGAGCATGCAGCGTCCCAT
CCAGAAGATCCTGCCTTGATCTTCAGGTACGACTTAGATGACGAGAGCAACCCACGAAATATCACGTGGTCCTAC
GCCGGGCTCAACGCTTTGGCCGACAAACTCGCAGAGCATCTGCTTCAGACTGGCGCACGAGTGGCAAACTCGCCG
ATACCTATTTGTATCGAGAAGAGCCCGGCCTTGTATGTTGCCATTCTTGGCATTCTCAAAGCTGGTGGTGCTTGG
TGCCCGATTGATACGCTCTCTCCTGCACAACGTCGCCACGACCTCATTGCACGGACCGGTTCAACAATCCTTCTG
GTCTCTAGTGTAGATGGAGAGCAGCCAGATGGTTCAATTCCCATTGGTGTCGAGACAATTGACGTTGGCAAATTC
ACCATCGACGAACCCATCTATGCGAACGGAGTGGTACGGGGCGCGTCTAGGGACCGGGCTACTCCTGATGGCATG
GCGTATCTCATCTGGACGAGCGGTACAACAGGAGCACCGAAAGGTGTCCCGATCAAGCATTCTTCGGCTGTCTCG
AGTATGAAATCACTTCAGAAGGATATCCCTACTGATGTAGCTGGCGGGGTACGTTGCTTGCAGTTTTCACAGTAC
ACCTTCGACGTTTCGATCCAGGACATCTTCTACACCTGGGGTGTGGGGGGCGTTCTTATCTCTGCATCGAGAGAG
ATCATGCTTGGTTCGTTCTCAAAGCTTGCGAACACCACGAATGCCACACACGCACACCTGACTCCAGCCTTCTCG
GCAGGTGTCTCCCGAAAATCATGCCCGACACTTCAAGTAATCACTATGATCGGTGAGAAGCTGACGCAACCTGTG
GCCGATGACTGGGGTACCGATATGAGAGCATTCAATACTTACGGGCCCGCCGAAGTGACAGTGGTTTCCACGATC
AGGGAGTTTGGTAACGAACACAAAAACATCAAGAGCGCGAACATTGGCTGGCCTATGGATACTGTGTCTGTGTTT
GTAACAAACAAGCAGCGGCTCATCATGAAGAATGCTATAGGCGAGCTGGCGCTGGGCGGACCACAACTTTCTCCT
GGTTATCTGAATCAAGAGGATGTCACCAAGGCCAAGTATGTCTGGAACGAAGAGGTTGGTCAGATGGTGTACTAC
ACTGGAGATTTGGTTCGCATGCTTGCTGACGGATCCCTGGAGTACATCAATCGTGTTGATGACTTGGTCAAACTG
GGAGGTATCAGAGTGGAGCTGAGCGAGATCAGCTTCTCGCTCGGCGAGTGCCATCCTCTGGTTGAGAATATTGAG
ACGCTTATTCTCAACCGCCCAGACCGGCCTAACAAGGTTGTGGTCGCCTTCCTCTCTGCTTCGAAAGCTACACGC
ACCGAAGACGAGCAGCTCTTGATGATCGATAAGGCGGCGCTTGAGATTGCCCGTGCTGCCAGCGAGAAAGCACAA
AGCGTTCTACCTGACCACATGATACCGTCTGTATACCTTGTGGTCTCGCACATCCCGAGAACATCATCCGCCAAG
ACAGATCGCAGGGCCTTGGAAGCTGCCTATGCCGGTGTGGATATCGATAGTTGGGAGAAAGAGATGAATCCAGAA
ATCAAATCTTCTGCAGCGGACTCCCAGGACCAGCACACCGCGACCATAACACACCGGGTAGTAGAAATGATTTCT
ACCTTGGCCAATATCTCCCAGTCAATTATCACGAAGTCCAGCCGCCTGGGGAGTCTGGGTATCGACTCTATTCGC
GCAATCCGGCTTGCCTCTAGACTCAAGGAGGCCGGTCATCAATTGTCTGTTGTGGAGGTCCTAAATTGTGTGACT
GTCCAGGATCTTGTCCAACTGGCCTCGTCATCTACTGTAGTGGAGAAGCCCACCTTCGAAACGTTCGACGTTAGG
GCATTCCATGACACCTGGCACACAGCCACAGTCAGCAAAGTACCGGAGGGATTCATAACTGTGCGCGCGACCACG
ATCCAGGAAAGTCTTCTTAGTGAGACAATGGGTACATACAACAGATATTGGAGTAATCATTTCTTTCTGCTTGAC
AGCTCGGTGGATGCGACGCGAATGAAACAGGCTTGGCTTGCAACGAGCCAGAAGGTGGAGGCTCTGAGAACTGGC
TTTATCCCTGTTGCGGAGGTCGATGACGGGAAAAGCCGATCGCAAGGAAAACTTGACTTTTCTATATTGCAAATC
ATTTACACGCTACCAGATGTTGATTGGGAATACATCAACTGTTCAGAGCAGGATCTGGTGGAGCATCGCGAAAAT
CGGATTGAGGAGATCATGACCAAACACCAGAAGAACTATTTTAAATATCCCCCATGGGCCGTTACAGTATTCGAC
ACAGGCAAAAGGCAGCTCATGATCCTCACCCTCCATCATTCGATTCATGACGAACCTTCCCTGGGACTTATAATG
GATGATGTGCGATCAGCTTATGCTTATAAACCTCCTCAAAGACATCAACTCAGTGATGCGCTCTCGATCGTTCTA
CCAGGAGAAAATCGGAGCAAGGAGACCAGAAGCTTTTGGAAAACCGAACTCAAGAAATTTGCAGAGCTTGATGCG
CCAGTGTGGCCCGATCTCACTGGGAAGAGGTTGCAGCCAGGCGAAGTCCCCAAGCATATCTTGATTACAGAAGAG
TCGCCTTTAACGGAGCCTGTTGACAACCTGCAGTCGTTTGCAGCCCAACTTGGGGTCTCATCCATTGCCTTGATT
ATCCGAGCCGCATGGGCCTATGTTTCGCTGGCTTATCTCGGTCTTCCAGCGACAGTCTTTGCTGAGACTCTCTCT
GACAGAGTTCTGCATGCTGACCTTGAAGACTGCATTGGACCCCTCATCTCCGTTGTACCTATTCCGTTCCATCCA
ACGGGAAACACTCGTGAGCTACTTACCAAGCAGCATCGCATCTCTGTTCAGTCCTGGAAGTATCGCCATATCCAT
GCTCGCGAGGTCCGAAAGATTCTCAAGAGACCCAGGGGTGAGGCCTTATATCCGGCGGTGTTCAACTTCCACGTC
GCGAAAGAAGAGGGTGCAAACGTCACTCAGCCTAGCATCTGGCGCGAACTCGAAGATGAGGTCGGGCTGCATGTT
GAGCATCCCATGGCCATGAACGTTTTCCAACATATGGATGGCTCTATAGTCCTCGAGGCAACTGCGGACAGCAGC
ATAATGTGTCGGGCACAGCTGTCACTATTCATTCGTCAGATTGACGGGCTTATCAGTTCAATGCTCGCATCTCCA
GACCAGCCCCTTGCAAGTCTAATCAACCGCTTTCCTTCGCCATTACGATCGCTATCGAATCAGCCTGTCAGAGAA
GAAGTAGTGAAGTCTGTTCGACTGAGCCCTACGCACTGGTTAGAGGTGTATGCGAAGAACCACCCTGAATGGACA
GCCGTTGAGGTAGCCAGTGAAATTTCCTCAAACGGGATTGTGAAGGAAGCTATGACCTTCGGTACATTAAACTCT
GAAGCAAACCGTGTTGCGGCCTACCTGGCATCTCTTGGTCATAAGAACAGGATGATCGGAGTCTGTATTGGGCGA
AACCTGCCCTCTTATCCCATCATAATCGGTATCTTCAAGTCAGGAAATGCTTACCTTCCAATCGAAGAAAACCTT
CCGGAGGATCGCAAAGCTTTTCTCATCAAGGATAGTGATTGTCCTATTGTTTTCACCGAAACGGCGTTCGTGAGC
ACGTTCCAAAGTACCCCCGAGGGATGTCGCGTGATAACCATCGACAACTCGGAGCTCTTGGGCTCACTTGCCACC
ATGCCAACAGAAGATCAAGACTATAACTCCGATCCCAACGATCTGGCATATCTTTTATTTACCTCAGGCTCGACA
GGAAAACCGAAGGGTGTGATGGTGACCCGAGGCAACCTTTCATCTTTCATCGAGTCGATCTCGGTGTTCACAGGC
CGGTATGCCCCCGCTACGTATGATCTGGGCGGCACTGGAAGATATCTCGCGCAGGCCAGTCGAGCTTTTGATCCC
CATCTGTTGGAAATGCTCTTCCCATGGCGCCATGGGATGGCTACTGTTACAGCTCCTAGGATGATGATTTTGGAT
GACCTTGGGATAACCTTGTCCAAGTGGGATATCACTCATGCAAGTCTGGTGCCATCTCTTCTGGATCAAGCAAAT
ATTGTACCAGAGCAATGTCCCAAGTTGAGATTCATGACTGTTGGTGGAGAAAAGATTTCACAGAAGGTATTGGAC
ACCTGGGCGGGAACACCAAACATGGCGCTTATCAACGCATACGGCCCGACAGAGGTAACCATCGGCTGCACATTC
GCTCCTGTCGGAAAAGACACAAACTTGCGCAATATCGGACCTCCCCTAGCAGCCTGTGTGTCTCATGTCCTTGTC
CCTGGTACCCTTAACTATGCTCTGAGAGGCCAGGCTGGCGAGCTATGCTTTTCTGGAGACCTCGTTGGAAGGGGC
TATCTCAACAGACCAGATGCCACTGGCTTCATCACCGGACCTAATGGTGAAAAAATGTACCGGACTGGTGATTTG
GGACGCATGATGCCAGACGACTCGGTCGAGTATCTTGGGCGTGGCGATGACCAGACCAAGATTCGTGGTCAAAGG
CTAGAGCTCGGTGAGGTATCTGAGGTGCTTCGCTCTTCGTCGACTGTTGGCGTTGATGTTGTCACGACCGTGGCC
AAACACCCTGGTCTTTCAAGAGTTCAACTTATCTCGTTCATCGCGCGGTCGGAAGCCCGTCAACGTGTGAAGAGC
GGGGATGTCACCTTCGTTATGTCCGACTTCGCAACGCTAGGCAAGGAACTTCGAGACTCTTGCAAGAGGAAGCTA
CCGGGCTACATGGTTCCCGAGCTTATTCTCCCCATCACTTATATACCTTTGGCACCGATGTCAGGAAAGGCAAAC
ATCAAAGAGCTACATGGCCTCTTCTCCAGCCTTCCTCTGCCTACTGTCCTTCAAGGTAACAGCTCGGCAAGTAAG
GACGGCGTCGTTATTGAACGGTCTTTGACTGCCGACGAAGAAGCTGTGATAAAAGAAGTCCTTGATGTTGTTTCG
GCGGATCCTTCGATTGTTGGACCCATGACGAACATCTTCGAAATTGGCCTCGATAGTCTAAGTGCCATAGGGCTT
ACGATTAAGCTCCGGAGAATTGGGTATGAAGTCACGGTAGCCATGGTCATGAGCAACCCGATCATTGAGCAGCTT
GCACGCTTACCTAGGGGTTCTTCGGACGCAGAGAGTGCTGTCTCGCAGACACGTCAAGCCTTTCAAAACATTGAG
TCTCAATACCGCCAACAACCGTCGCCCGGTGTCAACCCGTCCGATGTGGACACGGTCAGGCCTTGCTTGCCACTT
CAGGAAGGTTTGGTTGCTCGCTCAATAAATAGTGAAAGCGATCAACTCTATGTCAATCACATTGCCCTTAAACTC
GAGGCCTGTGTCGATAGTGAGAGGTTAAAATCTGCCTGGCAAGCCGTCTCCAATGACACCGAAATCCTGAGAACT
TCATTCGCTCCTTTGGACAAGCAAATGGTGCAAGTGGTCTACACGGTCGATTCTCATCAGTTTCCATGGAAGGAA
GAGGAGTATGAGAGCCTGAACGAAGCTATTGAGCATAACAAGGCACAACAGAAGCAGATCTCTGAGGATATCATT
GCAAACATCTCCACTGTCCCACCAGTGCGGTTCCTCATAGCCAAATCCTCCGAAACCAAGGAACCGCTTGCCCTC
TTCATTAACATTCATCATGCACTCTATGATGGAGAATCTTTCACGATGATAATGGAGGATGTGGCAGCGCGCTAT
GCAGACCAACCTATCCTTCAGAGAGGCTCGCCGGCGGCTTTCGTTGAATATGTTTATAGTCAGGATTCAGAAAAG
GCCAAGCAACACTGGGTCCGCTATCTGGAGGGATGCCATCCGACAACTTTCCGTACTGACTTCAATGCCATGGAG
CCTCCGGTCGTCGTACATAGAAGCCTTGGTGTGAAGCTTTCTGAACTGGAGCACCGCTCTGCAGCTCTTCAGACC
ACTGTACCATCCTTGGTGCAAGCGATTTTCGCACTCTTGCTGGCTGATACCGTTGGTGTGTCAGATTTGACCTAT
GGGTTGGTCCTGTCCGGTAGAGCCGTGTCGGTTCCCGGAGCCTCCTCGGTACTTCTGCCTTGCATCACTACTGTC
CCTGGTCGTCTCAATACCGCTAGCCTGGGTACAGTTGACGATGTTGTGGCGGATGTCCAAAAGTCTACGGTGGGG
TCGCTTGATTTCCAGCACACACCCCTAAGACATATACAGAGATGGATTAATGCGGAGACACCTCTGTTCGACTGT
CTATTTTCATATATTAGGACTGCTGCGCCACCAGAACACCGCCTGTGGCAGGAACTAAACAGCAATATGCCTGCC
GAGTATCCGTTGGCAGTGGAGGTCGAGGCCAACCATTCCATGGACACTGTTCAGCTCAACTGCTTCTTTTCATCT
GCTTTCGGCTCCCTATACAGTGGAAGTGAATTGATCGAGAAGATGGACGCAGTGCTCTCGAGCATTGCAGCAGGT
CAAAGTCTTTCGCTAGACGACTTCAATGTCTCTCATTCAGCAGCATCTGGTTCGCGTCCTGCTGTGCTGTGGGAC
AACACCACATGGTCCACCGCGGAAACCACGATTCGTGAATACACGATGTCTTTTTGCGGATTGACTTCGGCCGAA
GTCACTAAAGGCGCTTCTTTCTTGAGTTTGGGTGTTGATTCGGTCACGGCAATTCAATTTGCGCGTCAGCTACGG
GAAGCTGGGCTTCAGGTTTCTTCTGCTGATATTATGCGTTTCTCATGCGTTGGTGCGTTGGCCCAGCATGTGGAG
CAGAAAACACGTTCTCAGACCCCGGTTAACGGTACCAATGGGCACGAGAAGACGATTACCGGTATCCCTATTGAG
ACCTACGGCGAAAATGTCCGACTCCTTGCAGAGGATGACTCGATCTCTACAATGTTCGAAACTACGCCCCTGCAG
TCGGGAATGATTACGCAGACAATTGCTTCTAGCGGAAAGGTGTACGCTCACCCGCACATTATCAGATTAAAAGAC
TCGGTCGATACTACCCGACTGAAGGAGGCTCTTTTCAGAGTCATCGATGCAAATGATATTCTGCGGACATCCTTC
CACCTGATCGCTGAGCTTGGTTCCTCCTGGATTGCCGCCGTACACACCAATCCCCCTTTCCAGTGGGAGGAGCTC
ACATTGCCTTCCGGGGCCGATGTTCTGACTGAAGTCGACTCTCTTTATGATTTCAGCGAAGAGGCTTCTTTCGAG
GTCCCACCTATTCGGTCTGCTCTAGTCAACCAGCCTGAAGGCAAATTACTGGTTGTTGTTCTGCATCATGCTCTG
TATGATGGTTCTTCCATCCCCTTCCTGTTTGAGGACCTGGCCGTGTGCTATGAAGAAAGCAGTCTTCCGATAAGA
CCACAGTTCTCAGAGACTGTCCAGCATCTACTAAGCGGTCAAGAAAAAGCTTGCGAATTCTGGACAGAAAGACTA
CTCGGATATGAAGCCACTGAACTTCCTGAGCTTCCTCATCCTGAGTCGTCAGACCGCATGTTGCTTTCTGAATGC
CGGGTTGACCTTGACTTGTCGGCCATAGTGGATGCCTGCAAGGCAATGGAGGTCACCGTGCAGAGTGTATCTCTC
CTGGCCTATGCGAAGGTTCTAGCAGGTGTGGTCGGAAAACGTGATGTCGTCTTTGGACAAGTCCTTGCAGGCCGC
TCGTTGCCTGTTGCTGGTGCCGAACGAACCCTCGGGCCAATGTTCAATACAGTTGCTCAGAGGGTCTCTTTCGAG
CCCAAGTTCCTGAGTAACAAGGCCATGGCCCAGCGCTTACAACAGCATACAATTGATTCGCAGAGCCATCAGAAC
GCGCCACTCCGACTTGTGCAGAATTCTTTCAGGCAGGCTAACAACAGCATATCATCCATGCTTTTCGATACTCTC
TTCGTCTTCCAAAAGAGTGCGGACTTCGCTGGCAGTATCATAGAAGAGCAACAGATTTGGACACCTTATGAAGCA
GATGACTATGCCGCGCAGGCAGAATATAAGCTCAATGTTGAGGTCGATCATGCTTGCGATGGACTTGTGGTACAA
GCAACTTGCAACGGCCGGTACATCTCCCAGGAAACGCTTGACCAACTGATGGATGAATTCGCCATTGCGTTCCGT
GACATTATCGAGCATCCTACTAGATGCGCTACCATCGTGCCACAAGGACTTGGTGAGTTACCGACAAAGCTGTCT
GTTGAGCAGTCGCTCGACCCCGATGTTGAATCATCCGAAGTACCATCCCATGAGGCCATCATCCAGTCTGTGCTC
GCTGAGATTGCCGGAATTCCTGTGGACAACATCAAACCAAACACTAGCATCTTCAATATCGGGCTAGACTCTCTC
ACAGCTATCCGCATTGCTTCGATTTGCCGATCGAAGGGTTTGAAAATCGGGGTAGCCGACATCCTTCAGGGGAAC
ACCCTGCGTGGGATCAGCCAACGCATCCAGCCATTGTCCGAACAGGCAATCCAACCTCGGGGTTCATTTATCAAA
AATTACACCGAGGTGGAAACCACTGTGCTCCAACAGCTCAACCTCAGCAAGGACTCTATCGAAGCCATTCTACCT
TGTCTCGGTGGCCAATTCTATCATTTAGTCAGCTGGTTGAAATCTGGACGGAAGCTGCTCGAACCTGCCTGGGCA
TATGCCTGCTCCGGGCGCATCGACAGTACTAAAATTGAGGAAGCTTGGTTCCAGCTCCGCCAAAGGCATCCTATC
CTCCGCACCTGCTTTGCAGCTATATCCTCGTCGGAAGCGGTACAGGTTGTTCACAAACAGGCAATGCGTGGTGCG
GGCACATTCCAGGTTATCGAGACCGCTACACCTCTTTCTGAAGCAGCCCAAGCACAAGCAAGAGAAGAGGCTCTC
CATCCATCCTCGCTTTTTACACCTCCCGTCAGACTTCGTCTATTGAAAGCTAGCGACAACGATGGTATTCTCCTC
CTCATAAACCACGCCGCGTATGACGCATGGACCATGCCAATGTTCGTTAAAGAGCTAGCAGAGCTCTACAATGGC
CAACGCCCCGCAACTAACACTGACTTCCCTGCATTCGTCGACTTCTCAATGTGCTCTCTCCAGAGCCTCGATGAA
AAGCAATACTGGAACACTACTCTCGGTGACGCCTCTCCTACCATCATCCGCAACACTCGCACCGAAACCCAGCCT
ACCCCAGACCAGCTCTTCATCGGAGTCTGGGAAAAGGTCAAGGACCTCTCCCAACTCGAGACAAAATGCCGATCC
TCCAACGTCAGTCTACAAACCGTGGTCCTCTTCGCCATAGCCCGCTGCATCGCACGTCTTACCGACGTCCAAAAC
CCAACAATGGGTCTCTACCAAGCCGGTCGCTCTGCCTCCTTCAACAACGTCGAGAACCTCTCCGGACCCTGTCTG
AACGTTAACCCATTCACCATCCCTAATGCAGACACCAACCCCATCGACACTGATCTTCTTACTCAAGTTCGTGCT
ATCCAATCCTCTCTCGCGGACCGCGTCTCCTACGAACAAAGTTCCCTCCGCAACATCCTCCAGTGGATCTCACCC
GAGAAACCCCTCTTCAACACCTGGGTGAATCTCCTCTGGACACAGAACACTATCTCCTCGAATGCCAATTCCACA
TCAGATGGTACTGAGGACTTCTTCTCCCCGTTGCGGATCGGTGTCCCTACAGACTTCATCCCCGAACAGCCTTTG
GCTGAAGAAGTCACTGCCGTGTCGGCACTAGATACGGAATTCCTGCCGTCAGAAAATGTGTTCATTGATGTTGGT
CCAGATGCCAAGACGGATTCTATCGGGTTTGGTGTTCGAGTTGAAGGGGGAGTCATGAGTGTCGAGGAGGTGCAT
AAGCTTGTTGATGAAATTACGGGAGAGATTGAGAGAATTATGGGGATGTTGGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail