Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g3488.t1
Gene name
Locationscaffold_019:333355..335320
Strand+
Gene length (bp)1965
Transcript length (bp)1491
Coding sequence length (bp)1491
Protein length (aa) 497

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.8E-35 57 420
PF06779 MFS_4 Uncharacterised MFS-type transporter YbfB 3.0E-07 78 238

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.5

Transmembrane Domains

Domain # Start End Length
1 53 75 22
2 90 112 22
3 119 141 22
4 145 167 22
5 180 202 22
6 212 229 17
7 281 303 22
8 313 335 22
9 347 369 22
10 373 395 22
11 402 424 22
12 434 456 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g3488.t1
MTEFTTEKKEECGGDHEAVKTSFDNGVIELESMPQFSAEAEKRLVRKIDFRILPIMLVAYMMSFVDKQTLNYSAI
MGLLTDLKLHGTEYSWTSSIFYFGYLAFSYPASLLLVKFPLGKYLACTYLCWAVVLACHAATTNFTGLMVARFFL
GCAEASVTPGFGLLTSLWYRTSEQPLRHGIWFCGNSLSLVLGNAIAVGIWQIKDSLASWKWMFIIFGIVTFLWGF
LMLLRLPDSPTNASFLTDEERVIALARLKANKAGYKNNKIEWDQVIEAFTDPKTWFLAVFVLGCNIPNGGYTTFS
GLILKGFGYDTEHTLLLGMPGGFIVFLIILISCFTSTKISNSRCITSIILSCVSILGTALVNSTTTIASRYIGLI
LMSLYSVSLPLSLAMISANIGGITKRATVSAIYFIMYCVGNIIGPQLFFESQAPRYQSGFIAVFVCLAVVVVDLA
AFVVYLRWENARRDRLGTGMGMREGEEREVLADVTDLKNPGFRYVY*
Coding >Ani_SJS72_1|g3488.t1
ATGACAGAGTTTACGACTGAAAAGAAGGAGGAGTGCGGTGGTGATCATGAGGCTGTGAAGACAAGTTTTGATAAT
GGAGTTATTGAATTGGAGTCGATGCCTCAGTTTTCTGCTGAGGCGGAGAAGAGGCTTGTGAGGAAGATTGATTTT
CGGATTCTTCCTATCATGCTGGTCGCGTATATGATGTCGTTTGTGGATAAGCAGACGTTGAATTACTCTGCTATT
ATGGGTCTTTTGACTGACCTGAAGCTGCATGGTACGGAGTATAGTTGGACCTCGTCGATATTTTATTTTGGGTAT
CTTGCGTTTAGTTATCCCGCATCACTGCTTCTCGTCAAGTTCCCCTTGGGAAAATACCTAGCGTGCACATATCTC
TGCTGGGCCGTTGTCCTCGCATGTCATGCTGCTACTACAAATTTCACCGGGCTCATGGTCGCCCGGTTCTTCCTA
GGCTGCGCAGAAGCCAGCGTGACCCCGGGATTCGGCCTACTCACGTCTCTATGGTATCGCACGTCCGAACAACCT
CTTCGCCACGGGATCTGGTTCTGCGGCAATAGTTTGTCATTGGTGCTTGGGAATGCCATTGCTGTGGGTATCTGG
CAGATCAAAGACAGCTTAGCGTCATGGAAGTGGATGTTCATCATCTTCGGCATCGTCACATTCCTTTGGGGCTTC
CTAATGCTCCTTCGACTGCCCGACTCACCCACAAATGCTTCTTTCCTAACAGACGAGGAGAGGGTCATTGCCCTG
GCACGACTGAAGGCAAACAAAGCCGGTTACAAGAACAATAAGATTGAATGGGATCAAGTCATCGAAGCGTTCACA
GACCCGAAGACCTGGTTTTTGGCTGTGTTTGTTCTGGGTTGCAATATCCCCAATGGGGGCTATACGACGTTCTCC
GGTCTCATCCTCAAGGGCTTCGGATACGACACCGAACATACCCTGTTACTGGGCATGCCCGGAGGATTCATCGTC
TTCCTCATCATCCTGATATCCTGCTTCACCTCGACCAAAATCTCCAATAGCCGCTGCATAACCTCCATCATACTC
TCTTGCGTCAGTATCCTAGGAACCGCCCTCGTCAACAGCACCACCACCATCGCATCCCGCTACATCGGCCTCATT
CTCATGAGCCTCTACTCCGTCAGCCTCCCCCTCTCGTTGGCCATGATCAGCGCCAACATCGGCGGCATCACCAAG
CGAGCCACCGTCAGCGCCATATACTTTATCATGTATTGCGTGGGGAATATTATCGGGCCGCAGCTGTTCTTTGAG
AGTCAGGCGCCGAGGTATCAGAGTGGATTTATAGCCGTGTTTGTGTGTTTGGCCGTTGTGGTAGTGGATCTTGCG
GCGTTTGTTGTGTATTTGAGGTGGGAGAATGCGAGGAGGGATAGGTTGGGAACGGGGATGGGGATGAGGGAGGGA
GAGGAGAGGGAGGTGTTGGCTGATGTCACGGATTTGAAGAACCCGGGGTTTAGGTATGTTTATTGA
Transcript >Ani_SJS72_1|g3488.t1
ATGACAGAGTTTACGACTGAAAAGAAGGAGGAGTGCGGTGGTGATCATGAGGCTGTGAAGACAAGTTTTGATAAT
GGAGTTATTGAATTGGAGTCGATGCCTCAGTTTTCTGCTGAGGCGGAGAAGAGGCTTGTGAGGAAGATTGATTTT
CGGATTCTTCCTATCATGCTGGTCGCGTATATGATGTCGTTTGTGGATAAGCAGACGTTGAATTACTCTGCTATT
ATGGGTCTTTTGACTGACCTGAAGCTGCATGGTACGGAGTATAGTTGGACCTCGTCGATATTTTATTTTGGGTAT
CTTGCGTTTAGTTATCCCGCATCACTGCTTCTCGTCAAGTTCCCCTTGGGAAAATACCTAGCGTGCACATATCTC
TGCTGGGCCGTTGTCCTCGCATGTCATGCTGCTACTACAAATTTCACCGGGCTCATGGTCGCCCGGTTCTTCCTA
GGCTGCGCAGAAGCCAGCGTGACCCCGGGATTCGGCCTACTCACGTCTCTATGGTATCGCACGTCCGAACAACCT
CTTCGCCACGGGATCTGGTTCTGCGGCAATAGTTTGTCATTGGTGCTTGGGAATGCCATTGCTGTGGGTATCTGG
CAGATCAAAGACAGCTTAGCGTCATGGAAGTGGATGTTCATCATCTTCGGCATCGTCACATTCCTTTGGGGCTTC
CTAATGCTCCTTCGACTGCCCGACTCACCCACAAATGCTTCTTTCCTAACAGACGAGGAGAGGGTCATTGCCCTG
GCACGACTGAAGGCAAACAAAGCCGGTTACAAGAACAATAAGATTGAATGGGATCAAGTCATCGAAGCGTTCACA
GACCCGAAGACCTGGTTTTTGGCTGTGTTTGTTCTGGGTTGCAATATCCCCAATGGGGGCTATACGACGTTCTCC
GGTCTCATCCTCAAGGGCTTCGGATACGACACCGAACATACCCTGTTACTGGGCATGCCCGGAGGATTCATCGTC
TTCCTCATCATCCTGATATCCTGCTTCACCTCGACCAAAATCTCCAATAGCCGCTGCATAACCTCCATCATACTC
TCTTGCGTCAGTATCCTAGGAACCGCCCTCGTCAACAGCACCACCACCATCGCATCCCGCTACATCGGCCTCATT
CTCATGAGCCTCTACTCCGTCAGCCTCCCCCTCTCGTTGGCCATGATCAGCGCCAACATCGGCGGCATCACCAAG
CGAGCCACCGTCAGCGCCATATACTTTATCATGTATTGCGTGGGGAATATTATCGGGCCGCAGCTGTTCTTTGAG
AGTCAGGCGCCGAGGTATCAGAGTGGATTTATAGCCGTGTTTGTGTGTTTGGCCGTTGTGGTAGTGGATCTTGCG
GCGTTTGTTGTGTATTTGAGGTGGGAGAATGCGAGGAGGGATAGGTTGGGAACGGGGATGGGGATGAGGGAGGGA
GAGGAGAGGGAGGTGTTGGCTGATGTCACGGATTTGAAGAACCCGGGGTTTAGGTATGTTTATTGA
Gene >Ani_SJS72_1|g3488.t1
ATGACAGAGTTTACGACTGAAAAGAAGGAGGAGTGCGGTGGTGATCATGAGGCTGTGAAGACAAGTTTTGATAAT
GGAGTTATTGAATTGGAGTCGATGCCTCAGTTTTCTGCTGAGGCGGAGAAGAGGCTTGTGAGGAAGATTGATTTT
CGGTATGCATGCTTTGAATCTGCCCCATGGGAGTGAGGAGAGTTAACGGTGACCCAGGATTCTTCCTATCATGCT
GGTCGCGTATATGATGTCGTTTGTGGATAAGCAGACGTTGAATTACTCTGCTATTATGGGTCTTTTGACTGACCT
GAAGCTGCATGGTACGGAGTATAGTTGGACCTCGTCGATATTTTATTTTGGGTATCTTGCGTTTAGGTAAGTTGA
CTACCACATGAAGTATAGGCTGAGTGAGCACTGTCTGATAAGTTGCATTCAGTTATCCCGCATCACTGCTTCTCG
TCAAGTTCCCCTTGGGAAAATACCTAGCGTGCACATAGTATGTCTCCTCTTCCTGACACCACCAAACCACACGCT
TATAGCTATAGTCTCTGCTGGGCCGTTGTCCTCGCATGTCATGCTGCTACTACAAATTTCACCGGGCTCATGGTC
GCCCGGTTCTTCCTAGGCTGCGCAGAAGCCAGCGTGACCCCGGGATTCGGCCTACTCACGTCTCTATGGTATCGC
ACGTCCGAACAACCTCTTCGCCACGGGATCTGGTTCTGCGGCAATAGTTTGTCATTGGTGCTTGGGAATGCCATT
GCTGTGGGTATCTGGCAGATCAAAGACAGCTTAGCGTCATGGAAGGTAGAGCCCTTACAGATTTTCTCATCTTGA
CACAAATCTGATATCTAACAGTGGATGTTCATCATCTTCGGCATCGTCACATTCCTTTGGGGCTTCCTAATGCTC
CTTCGACTGCCCGACTCACCCACAAATGCTTCTTTCCTAACAGACGAGGAGAGGGTCATTGCCCTGGCACGACTG
AAGGCAAACAAAGCCGGTTACAAGAACAATAAGATTGAATGGGATCAAGTCATCGAAGCGTTCACAGACCCGAAG
ACCTGGTTTTTGGCTGTGTTTGTTCTGGGTTGCAATATCCCCAATGGGGGCTATACGACGGTGAGTCTTTCATCT
TTGTGAGTAGATATGCGCGACTAAAGAGATGATACATAGTTCTCCGGTCTCATCCTCAAGGGCTTCGGATACGAC
ACCGAACATACCCTGTTACTGGGCATGCCCGGAGGATTCATCGTCTTCCTCATCATCCTGATATCGTATGACCTA
TCCCTATTATTCATTATCCTGACTACAAAGTCCATCCTCTAAAATTATACATTATTACAGCTGCTTCACCTCGAC
CAAAATCTCCAATAGCCGCTGCATAACCTCCATCATACTCTCTTGCGTCAGGTACACCTCACCCCCTCTCCAACC
CCTGCTATCACACTAACCAAAAGCAAAGTATCCTAGGAACCGCCCTCGTCAACAGCACCACCACCATCGCATCCC
GCTACATCGGCCTCATTCTCATGAGCCTCTACTCCGTCAGCCTCCCCCTCTCGTTGGCCATGATCAGCGCCAACA
TCGGCGGCATCACCAAGCGAGCCACCGTCAGCGCCATATACTTTATCATGTATTGCGTGGGGAATATTATCGGGC
CGCAGCTGTTCTTTGAGAGTCAGGCGCCGAGGTATCAGGTGTGTTTCCCAATTACTCGTTCTCCAATTGCGTGGC
CCTATTGAAAGTATGTGACTGATCTTGTGTTTTATGGTGGATTAGAGTGGATTTATAGCCGTGTTTGTGTGTTTG
GCCGTTGTGGTAGTGGATCTTGCGGCGTTTGTTGTGTATTTGAGGTGGGAGAATGCGAGGAGGGATAGGTTGGGA
ACGGGGATGGGGATGAGGGAGGGAGAGGAGAGGGAGGTGTTGGCTGATGTCACGGATTTGAAGAACCCGGGGTTT
AGGTATGTTTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail