Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g339.t1
Gene name
Locationscaffold_002:11410..12321
Strand-
Gene length (bp)911
Transcript length (bp)852
Coding sequence length (bp)852
Protein length (aa) 284

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04479 RTA1 RTA1 like protein 8.8E-73 46 259

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 15 33 18
2 40 62 22
3 82 104 22
4 117 139 22
5 154 176 22
6 200 217 17
7 232 251 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g339.t1
MSSNYKLYEYDPSVGAAIVSAGLFAATSMVHLFQMIRRRTWCFVPFVLGGFFETFGYIARYFSARETPDWTVKPY
VGQELLLLLAPALFSASIYMILGRIIRLLDGHTYSLIRPSWLTKIFVTGDVLSFFIQSGGGGIMASAKTPSKVSL
GNNIIVVGLIVQLVFFGFFIIVTVVFHRRMAASPTEVSVIITQWHTYMRILYAASVLIMVRSVYRVLEYLQGSEG
GLKQNEMFLYIFDALLMFSCCVLFNVMHPNRILSARPEAYDKMMEVEEDQVEMLRRRR*
Coding >Ani_SJS72_1|g339.t1
ATGTCGAGTAACTACAAGCTCTATGAATATGACCCCTCTGTCGGCGCTGCTATTGTCTCTGCCGGACTGTTCGCC
GCAACCTCCATGGTGCATCTTTTCCAGATGATCCGCAGGCGGACATGGTGCTTTGTACCATTTGTTCTTGGTGGA
TTCTTTGAAACATTCGGATACATCGCCCGTTACTTCAGCGCCAGAGAGACCCCAGATTGGACCGTGAAGCCCTAC
GTCGGACAAGAACTGCTGCTTCTTCTAGCTCCGGCTCTCTTCTCCGCCTCCATCTACATGATCCTGGGCCGAATC
ATCCGCCTCCTCGACGGCCACACATACTCGCTAATCCGGCCATCATGGCTGACCAAGATATTCGTAACCGGCGAT
GTGCTCTCATTCTTCATCCAAAGTGGCGGCGGCGGCATAATGGCATCTGCGAAGACCCCCAGCAAGGTCTCCTTG
GGCAATAACATCATCGTGGTCGGTCTTATCGTTCAGTTGGTCTTTTTCGGCTTCTTCATCATTGTCACTGTGGTC
TTTCATCGCCGTATGGCTGCTTCGCCGACTGAAGTGTCCGTGATAATCACACAGTGGCACACCTATATGCGCATC
TTGTATGCGGCTAGTGTTCTCATCATGGTGCGGTCCGTCTATCGTGTGCTGGAGTATCTGCAGGGTTCGGAGGGA
GGTTTGAAACAAAATGAGATGTTCCTTTATATTTTTGATGCTCTGTTAATGTTTTCGTGTTGTGTTTTGTTCAAT
GTCATGCACCCGAATCGTATACTCTCAGCTCGTCCGGAGGCTTACGACAAGATGATGGAAGTGGAGGAGGATCAG
GTGGAGATGCTGCGACGAAGACGTTGA
Transcript >Ani_SJS72_1|g339.t1
ATGTCGAGTAACTACAAGCTCTATGAATATGACCCCTCTGTCGGCGCTGCTATTGTCTCTGCCGGACTGTTCGCC
GCAACCTCCATGGTGCATCTTTTCCAGATGATCCGCAGGCGGACATGGTGCTTTGTACCATTTGTTCTTGGTGGA
TTCTTTGAAACATTCGGATACATCGCCCGTTACTTCAGCGCCAGAGAGACCCCAGATTGGACCGTGAAGCCCTAC
GTCGGACAAGAACTGCTGCTTCTTCTAGCTCCGGCTCTCTTCTCCGCCTCCATCTACATGATCCTGGGCCGAATC
ATCCGCCTCCTCGACGGCCACACATACTCGCTAATCCGGCCATCATGGCTGACCAAGATATTCGTAACCGGCGAT
GTGCTCTCATTCTTCATCCAAAGTGGCGGCGGCGGCATAATGGCATCTGCGAAGACCCCCAGCAAGGTCTCCTTG
GGCAATAACATCATCGTGGTCGGTCTTATCGTTCAGTTGGTCTTTTTCGGCTTCTTCATCATTGTCACTGTGGTC
TTTCATCGCCGTATGGCTGCTTCGCCGACTGAAGTGTCCGTGATAATCACACAGTGGCACACCTATATGCGCATC
TTGTATGCGGCTAGTGTTCTCATCATGGTGCGGTCCGTCTATCGTGTGCTGGAGTATCTGCAGGGTTCGGAGGGA
GGTTTGAAACAAAATGAGATGTTCCTTTATATTTTTGATGCTCTGTTAATGTTTTCGTGTTGTGTTTTGTTCAAT
GTCATGCACCCGAATCGTATACTCTCAGCTCGTCCGGAGGCTTACGACAAGATGATGGAAGTGGAGGAGGATCAG
GTGGAGATGCTGCGACGAAGACGTTGA
Gene >Ani_SJS72_1|g339.t1
ATGTCGAGTAACTACAAGCTCTATGAATATGACCCCTCTGTCGGCGCTGCTATTGTCTCTGCCGGACTGTTCGCC
GCAACCTCCATGGTGCATCTTTTCCAGATGATCCGCAGGCGGACATGGTGCTTTGTACCATTTGTTCTTGGTGGA
TTCTGTGTGTTCCCTCATCCCCTCAAGTATTCATCACCTTGCTAATGCCTTAATTCCTTCCAGTTGAAACATTCG
GATACATCGCCCGTTACTTCAGCGCCAGAGAGACCCCAGATTGGACCGTGAAGCCCTACGTCGGACAAGAACTGC
TGCTTCTTCTAGCTCCGGCTCTCTTCTCCGCCTCCATCTACATGATCCTGGGCCGAATCATCCGCCTCCTCGACG
GCCACACATACTCGCTAATCCGGCCATCATGGCTGACCAAGATATTCGTAACCGGCGATGTGCTCTCATTCTTCA
TCCAAAGTGGCGGCGGCGGCATAATGGCATCTGCGAAGACCCCCAGCAAGGTCTCCTTGGGCAATAACATCATCG
TGGTCGGTCTTATCGTTCAGTTGGTCTTTTTCGGCTTCTTCATCATTGTCACTGTGGTCTTTCATCGCCGTATGG
CTGCTTCGCCGACTGAAGTGTCCGTGATAATCACACAGTGGCACACCTATATGCGCATCTTGTATGCGGCTAGTG
TTCTCATCATGGTGCGGTCCGTCTATCGTGTGCTGGAGTATCTGCAGGGTTCGGAGGGAGGTTTGAAACAAAATG
AGATGTTCCTTTATATTTTTGATGCTCTGTTAATGTTTTCGTGTTGTGTTTTGTTCAATGTCATGCACCCGAATC
GTATACTCTCAGCTCGTCCGGAGGCTTACGACAAGATGATGGAAGTGGAGGAGGATCAGGTGGAGATGCTGCGAC
GAAGACGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail