Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g3252.t1
Gene name
Locationscaffold_018:18058..19267
Strand+
Gene length (bp)1209
Transcript length (bp)1209
Coding sequence length (bp)1209
Protein length (aa) 403

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01650 Peptidase_C13 Peptidase C13 family 2.6E-40 30 260

GO

GO Term Description Terminal node
GO:0008233 peptidase activity Yes
GO:0006508 proteolysis Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g3252.t1
MLTLYSGLLRVLPLLLLAFTITVSSEHTSNWAVLVSTSRFWFNYRHLANVLSLYRTVKRLGIPDSQIILMLPDDM
ACNPRNAFPGTVYSNADRAVDLYGDNIEVDYRGYEVTVENFIRLLTDRLDEDVPRSKRLGSDAGSNVLVYMTGHG
GDQFLKFQDSEEIGAWDLADAFGQMWEKKRYHELLFMIDTCQANTMYTHFYSPNIIATGSSELDQSSYSHHADND
VGVAVIDRWTYYVLEFLETQVTSANSKLTLGDLFDSYDESKIHSQPGVRWDLFPGGEQEGRLRTVADFFGNVQNV
EVENINATEPGSLKEDLIEIARLVDKWRARDQDYFVRQNESSVSKDASVYEESSPHYTVRSKVGPAKMSEESTWQ
KRLVGISVLGACAAVWLTGSILGGTSA*
Coding >Ani_SJS72_1|g3252.t1
ATGTTGACGCTCTATTCCGGACTCCTTCGAGTCCTGCCCTTACTACTACTCGCCTTCACCATCACAGTGTCCTCC
GAGCATACTTCCAACTGGGCCGTCCTCGTCTCAACCTCCCGATTCTGGTTCAACTACCGTCATCTCGCCAATGTC
CTCTCCTTGTACCGCACCGTCAAGCGGTTGGGCATCCCCGACTCGCAGATCATCCTGATGCTCCCCGATGACATG
GCCTGCAATCCTCGCAATGCCTTTCCCGGAACCGTTTACAGTAACGCAGATCGCGCCGTTGATCTCTACGGCGAC
AACATCGAGGTCGACTATCGGGGGTACGAGGTCACCGTGGAGAACTTCATCCGCCTCCTGACGGATCGCCTGGAC
GAAGATGTACCACGCAGCAAGCGACTAGGCTCCGACGCTGGTAGTAACGTTTTGGTCTATATGACCGGTCACGGC
GGCGACCAGTTTCTGAAATTCCAAGACTCCGAGGAAATCGGAGCCTGGGACCTGGCGGACGCCTTCGGTCAGATG
TGGGAAAAGAAGCGCTACCATGAGCTTCTGTTTATGATTGATACCTGCCAGGCCAACACCATGTACACGCATTTC
TACTCGCCGAATATCATCGCCACCGGATCCAGTGAGCTTGACCAATCTTCCTACTCTCACCATGCGGACAATGAT
GTCGGGGTTGCGGTGATCGACCGCTGGACATACTATGTGTTGGAATTTTTGGAAACACAGGTGACAAGTGCCAAT
TCGAAGCTCACGCTGGGCGACTTGTTCGATTCGTACGACGAGTCCAAGATCCATTCCCAGCCGGGTGTAAGGTGG
GACCTGTTTCCCGGCGGCGAGCAGGAGGGACGGCTTCGCACCGTGGCAGACTTCTTTGGGAATGTGCAGAACGTC
GAAGTTGAGAATATCAATGCAACCGAGCCGGGCTCGTTGAAGGAGGATTTGATTGAGATTGCCCGGCTCGTGGAC
AAATGGCGTGCTCGCGACCAGGACTATTTCGTCCGACAGAACGAGTCATCAGTGTCGAAGGATGCCAGCGTGTAT
GAGGAATCTTCCCCGCATTACACGGTCAGGTCCAAGGTTGGGCCGGCGAAGATGTCGGAGGAATCTACGTGGCAG
AAGCGGTTGGTCGGAATTTCCGTCCTAGGCGCGTGTGCTGCTGTCTGGCTTACGGGATCGATCTTGGGCGGGACC
TCGGCTTGA
Transcript >Ani_SJS72_1|g3252.t1
ATGTTGACGCTCTATTCCGGACTCCTTCGAGTCCTGCCCTTACTACTACTCGCCTTCACCATCACAGTGTCCTCC
GAGCATACTTCCAACTGGGCCGTCCTCGTCTCAACCTCCCGATTCTGGTTCAACTACCGTCATCTCGCCAATGTC
CTCTCCTTGTACCGCACCGTCAAGCGGTTGGGCATCCCCGACTCGCAGATCATCCTGATGCTCCCCGATGACATG
GCCTGCAATCCTCGCAATGCCTTTCCCGGAACCGTTTACAGTAACGCAGATCGCGCCGTTGATCTCTACGGCGAC
AACATCGAGGTCGACTATCGGGGGTACGAGGTCACCGTGGAGAACTTCATCCGCCTCCTGACGGATCGCCTGGAC
GAAGATGTACCACGCAGCAAGCGACTAGGCTCCGACGCTGGTAGTAACGTTTTGGTCTATATGACCGGTCACGGC
GGCGACCAGTTTCTGAAATTCCAAGACTCCGAGGAAATCGGAGCCTGGGACCTGGCGGACGCCTTCGGTCAGATG
TGGGAAAAGAAGCGCTACCATGAGCTTCTGTTTATGATTGATACCTGCCAGGCCAACACCATGTACACGCATTTC
TACTCGCCGAATATCATCGCCACCGGATCCAGTGAGCTTGACCAATCTTCCTACTCTCACCATGCGGACAATGAT
GTCGGGGTTGCGGTGATCGACCGCTGGACATACTATGTGTTGGAATTTTTGGAAACACAGGTGACAAGTGCCAAT
TCGAAGCTCACGCTGGGCGACTTGTTCGATTCGTACGACGAGTCCAAGATCCATTCCCAGCCGGGTGTAAGGTGG
GACCTGTTTCCCGGCGGCGAGCAGGAGGGACGGCTTCGCACCGTGGCAGACTTCTTTGGGAATGTGCAGAACGTC
GAAGTTGAGAATATCAATGCAACCGAGCCGGGCTCGTTGAAGGAGGATTTGATTGAGATTGCCCGGCTCGTGGAC
AAATGGCGTGCTCGCGACCAGGACTATTTCGTCCGACAGAACGAGTCATCAGTGTCGAAGGATGCCAGCGTGTAT
GAGGAATCTTCCCCGCATTACACGGTCAGGTCCAAGGTTGGGCCGGCGAAGATGTCGGAGGAATCTACGTGGCAG
AAGCGGTTGGTCGGAATTTCCGTCCTAGGCGCGTGTGCTGCTGTCTGGCTTACGGGATCGATCTTGGGCGGGACC
TCGGCTTGA
Gene >Ani_SJS72_1|g3252.t1
ATGTTGACGCTCTATTCCGGACTCCTTCGAGTCCTGCCCTTACTACTACTCGCCTTCACCATCACAGTGTCCTCC
GAGCATACTTCCAACTGGGCCGTCCTCGTCTCAACCTCCCGATTCTGGTTCAACTACCGTCATCTCGCCAATGTC
CTCTCCTTGTACCGCACCGTCAAGCGGTTGGGCATCCCCGACTCGCAGATCATCCTGATGCTCCCCGATGACATG
GCCTGCAATCCTCGCAATGCCTTTCCCGGAACCGTTTACAGTAACGCAGATCGCGCCGTTGATCTCTACGGCGAC
AACATCGAGGTCGACTATCGGGGGTACGAGGTCACCGTGGAGAACTTCATCCGCCTCCTGACGGATCGCCTGGAC
GAAGATGTACCACGCAGCAAGCGACTAGGCTCCGACGCTGGTAGTAACGTTTTGGTCTATATGACCGGTCACGGC
GGCGACCAGTTTCTGAAATTCCAAGACTCCGAGGAAATCGGAGCCTGGGACCTGGCGGACGCCTTCGGTCAGATG
TGGGAAAAGAAGCGCTACCATGAGCTTCTGTTTATGATTGATACCTGCCAGGCCAACACCATGTACACGCATTTC
TACTCGCCGAATATCATCGCCACCGGATCCAGTGAGCTTGACCAATCTTCCTACTCTCACCATGCGGACAATGAT
GTCGGGGTTGCGGTGATCGACCGCTGGACATACTATGTGTTGGAATTTTTGGAAACACAGGTGACAAGTGCCAAT
TCGAAGCTCACGCTGGGCGACTTGTTCGATTCGTACGACGAGTCCAAGATCCATTCCCAGCCGGGTGTAAGGTGG
GACCTGTTTCCCGGCGGCGAGCAGGAGGGACGGCTTCGCACCGTGGCAGACTTCTTTGGGAATGTGCAGAACGTC
GAAGTTGAGAATATCAATGCAACCGAGCCGGGCTCGTTGAAGGAGGATTTGATTGAGATTGCCCGGCTCGTGGAC
AAATGGCGTGCTCGCGACCAGGACTATTTCGTCCGACAGAACGAGTCATCAGTGTCGAAGGATGCCAGCGTGTAT
GAGGAATCTTCCCCGCATTACACGGTCAGGTCCAAGGTTGGGCCGGCGAAGATGTCGGAGGAATCTACGTGGCAG
AAGCGGTTGGTCGGAATTTCCGTCCTAGGCGCGTGTGCTGCTGTCTGGCTTACGGGATCGATCTTGGGCGGGACC
TCGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail