Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g3154.t1
Gene name
Locationscaffold_017:166935..168207
Strand+
Gene length (bp)1272
Transcript length (bp)804
Coding sequence length (bp)804
Protein length (aa) 268

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 5 24 19
2 37 59 22
3 79 101 22
4 113 144 31
5 164 186 22
6 193 215 22
7 230 252 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g3154.t1
MYALPVGIVFLCLATVTVALRLYTRLKLVRKPGWDDLLIVLSLATDVVFFAFLVIEIQNGLAENEADLAPEVVRR
QLKALWITIPLYNLTLTLTKLSLIFLYRRLFPTHTYRILLILTLIFVIITGLWMVLSTLIFCIPINAFWDTSIPH
TCLPEDVVWCLNAAFQITTDLILVVLPLPILANLNLPKRQKAALLVIFALGFFVCATSIVRLSTIVHLLRDPDFT
SGNGLAATWSFVESNVAIICACLPPLRPLLQQKQPQANHHQR*
Coding >Ani_SJS72_1|g3154.t1
ATGTATGCCCTGCCCGTGGGAATCGTTTTCCTTTGCCTGGCGACGGTCACGGTCGCGTTGCGACTGTATACGCGA
TTGAAACTGGTGAGGAAACCGGGATGGGATGATTTGTTGATTGTGTTGTCGTTGGCGACTGATGTGGTGTTCTTC
GCTTTCCTTGTCATAGAAATCCAAAACGGCCTCGCCGAAAACGAAGCAGATCTTGCTCCGGAGGTGGTGAGGAGG
CAATTAAAGGCCCTCTGGATAACAATCCCCCTCTACAACCTGACCCTCACCCTCACCAAGTTATCCCTAATCTTC
CTCTACCGCCGCCTCTTCCCAACCCACACCTACCGCATCCTCCTCATCCTCACCCTCATCTTCGTCATCATAACC
GGCCTCTGGATGGTCCTCAGCACCTTGATCTTCTGCATCCCCATAAACGCCTTCTGGGATACGTCTATCCCGCAT
ACATGTCTCCCCGAGGATGTAGTATGGTGTCTGAACGCCGCGTTCCAGATCACCACTGATCTGATACTCGTTGTG
CTTCCCTTGCCCATCCTGGCGAATTTAAATCTGCCGAAAAGGCAGAAGGCCGCGCTGTTGGTTATTTTTGCATTA
GGGTTTTTTGTCTGCGCAACAAGCATCGTCCGTCTATCAACCATCGTCCATCTCCTCCGAGACCCAGACTTCACC
TCAGGAAACGGCCTCGCCGCAACCTGGTCCTTCGTCGAATCCAACGTCGCCATAATCTGCGCATGCCTACCCCCT
CTGCGCCCGCTCCTCCAGCAGAAGCAGCCGCAGGCCAACCACCACCAACGATAA
Transcript >Ani_SJS72_1|g3154.t1
ATGTATGCCCTGCCCGTGGGAATCGTTTTCCTTTGCCTGGCGACGGTCACGGTCGCGTTGCGACTGTATACGCGA
TTGAAACTGGTGAGGAAACCGGGATGGGATGATTTGTTGATTGTGTTGTCGTTGGCGACTGATGTGGTGTTCTTC
GCTTTCCTTGTCATAGAAATCCAAAACGGCCTCGCCGAAAACGAAGCAGATCTTGCTCCGGAGGTGGTGAGGAGG
CAATTAAAGGCCCTCTGGATAACAATCCCCCTCTACAACCTGACCCTCACCCTCACCAAGTTATCCCTAATCTTC
CTCTACCGCCGCCTCTTCCCAACCCACACCTACCGCATCCTCCTCATCCTCACCCTCATCTTCGTCATCATAACC
GGCCTCTGGATGGTCCTCAGCACCTTGATCTTCTGCATCCCCATAAACGCCTTCTGGGATACGTCTATCCCGCAT
ACATGTCTCCCCGAGGATGTAGTATGGTGTCTGAACGCCGCGTTCCAGATCACCACTGATCTGATACTCGTTGTG
CTTCCCTTGCCCATCCTGGCGAATTTAAATCTGCCGAAAAGGCAGAAGGCCGCGCTGTTGGTTATTTTTGCATTA
GGGTTTTTTGTCTGCGCAACAAGCATCGTCCGTCTATCAACCATCGTCCATCTCCTCCGAGACCCAGACTTCACC
TCAGGAAACGGCCTCGCCGCAACCTGGTCCTTCGTCGAATCCAACGTCGCCATAATCTGCGCATGCCTACCCCCT
CTGCGCCCGCTCCTCCAGCAGAAGCAGCCGCAGGCCAACCACCACCAACGATAA
Gene >Ani_SJS72_1|g3154.t1
ATGTATGCCCTGCCCGTGGGAATCGTTTTCCTTTGCCTGGCGACGGTCACGGTCGCGTTGCGACTGTATACGCGA
TTGAAACTGGTGAGGAAACCGGGATGGGATGATTTGTTGATTGTGTTGTCGTTGGTAGGCAGTATACTTTCTGAA
TAGTTGATATGCAGTGCTGATATGATGTGATGTGTTGAGCATAGGCGACTGATGTGGTGTTCTTCGCTTTCCTTG
TCATAGGTACGACGATGCGATGCTTGCATGCTATATCTTGAATGAACGATAAAAACTAACAATGTATACAATAGA
AATCCAAAACGGCCTCGCCGAAAACGAAGCAGATCTTGCTCCGGAGGTGGTGAGGAGGCAATTAAAGGTATACTC
CCCCTCTATACTACCCTATTTCCATACATGATATAGTTGCTAACCATGAAATGAATTAAATCAAGGCCCTCTGGA
TAACAATCCCCCTCTACAACCTGACCCTCACCCTCACCAAGTTATCCCTAATCTTCCTCTACCGCCGCCTCTTCC
CAACCCACACCTACCGCATCCTCCTCATCCTCACCCTCATCTTCGTCATCATAACCGGCCTCTGGATGGTCCTCA
GCACCTTGATCTTCTGCATCCCCATAAACGCCTTCTGGGATACGTCTATCCCGCATACATGTCTCCCCGAGGATG
TAGTATGGTGTCTGAACGCCGCGTTCCAGATCACCACTGATCTGATACTCGTTGTGCTTCCCTTGCCCATCCTGG
CGAATTTAAATCTGCCGAAAAGGCAGAAGGCCGCGCTGTTGGTTATTTTTGCATTAGGGTTTTTGTATGTCTCCC
TTACTCTCTTATCTTATACAACCCCAACCCACCCCCCCCCCTCCTCTTTCTTCCGTCGGTATAGGAAAGAACTAA
TGATGGTAATGGTTACAGTGTCTGCGCAACAAGCATCGTCCGTCTATCAACCATCGTCCATCTCCTCCGAGACCC
AGACTTCACCTGTATACTCCCTCCCGTACCCTATCCTACCCTATACCTCCAATCCATACTAACAAAATTCAACAG
CAGGAAACGGCCTCGCCGCAACCTGGTCCTTCGTCGAATCCAACGTCGCCATAATCTGCGCATGCCTACCCCCTC
TGCGCCCGCTCCTCGTGCGCATCTTCCCCAAACTAATCCCATCACGAATGCGCTCCTACCAGAGAGACAAAGACT
CCAGATCAAACAGCAATCCCAACAACAACAAAGCAGCAGAAGCAGCCGCAGGCCAACCACCACCAACGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail