Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g309.t1
Gene name
Locationscaffold_001:890737..892573
Strand+
Gene length (bp)1836
Transcript length (bp)1623
Coding sequence length (bp)1623
Protein length (aa) 541

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 3.3E-112 21 476
PF07690 MFS_1 Major Facilitator Superfamily 3.1E-20 68 390

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 74 93 19
2 103 125 22
3 160 182 22
4 192 214 22
5 280 302 22
6 317 339 22
7 346 368 22
8 378 400 22
9 413 435 22
10 440 462 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g309.t1
MARSYLGLTGGKLQIAISVIAGMDFLLFGYDQGVTGGLLTLQSFIKYFPTIATNGEYYESLTKAQQSTQSTRQGV
VVAAYNLGCFAGSIPTIWIGNMLGRRKTIFVGSFIMCIGALLQCTSYQLGQFIVGRLVTGFGNGMNTSTVPTWQS
ECCKSNHRGMLVMIEGAMITCGITISYWIDFGLLFADPNEVAWRFPLAFQIFFALIILVFVLPLPESPRWLILKG
REDEARTVLRSLLGDADETFIETEFTAIKATVLEMAKGSFRDMFTMTEDRHFHRVVLAYVNQMFQQISGINLITY
YIPVVLENQLGMTLENSRLISACNGTEYFLASWIAVFTIEHFGRRTLMLFGAAGMSISMVILAVTASIGSNGANI
ACIVFLFVFNTFFAIGWLGMTWLYPAEVVPLRIRAPANALATSSNWIFNFLVVMITPVAFDNIGYQTYIIFAVIN
AFIFPVVLFFYPETARRSLEEMDRIFRKTTSVFNVVKVANEEPHMYGKHGELLRTLDDVEDDAVRRASVLSHRAK
DMEKDSDENTNSVKA*
Coding >Ani_SJS72_1|g309.t1
ATGGCGCGGTCATACTTGGGCCTCACAGGAGGCAAGCTGCAAATCGCTATCAGTGTCATCGCTGGTATGGATTTC
TTGCTGTTCGGTTACGATCAAGGTGTCACTGGTGGTCTGTTGACCCTCCAATCGTTCATCAAATACTTTCCAACT
ATCGCAACCAACGGTGAATACTATGAGAGCTTGACTAAAGCGCAACAAAGTACCCAGTCGACTCGCCAAGGTGTC
GTTGTCGCTGCGTACAACTTGGGCTGCTTTGCTGGATCGATTCCCACAATTTGGATTGGCAACATGCTCGGTCGG
CGCAAAACTATCTTCGTTGGTTCGTTTATTATGTGCATCGGAGCTTTGCTGCAATGCACTTCCTACCAACTCGGG
CAATTCATTGTTGGACGCTTGGTTACTGGTTTCGGAAACGGCATGAACACCTCTACCGTGCCCACCTGGCAGTCA
GAGTGCTGTAAATCCAACCATCGTGGAATGCTAGTCATGATTGAAGGTGCCATGATTACTTGCGGTATCACCATC
AGTTACTGGATTGATTTCGGTCTGCTATTCGCCGATCCAAATGAGGTGGCTTGGCGATTCCCGCTGGCCTTCCAG
ATTTTCTTCGCCCTCATTATCCTGGTTTTCGTTTTGCCTCTTCCCGAGTCGCCCCGTTGGCTAATCCTCAAGGGC
CGCGAGGACGAAGCAAGGACTGTCCTGCGGTCCCTCTTGGGCGACGCTGACGAGACCTTCATTGAGACGGAATTT
ACGGCCATCAAGGCTACAGTCTTGGAAATGGCCAAGGGTTCGTTCCGTGACATGTTCACCATGACCGAGGACCGC
CACTTCCACCGCGTGGTCTTAGCCTACGTCAATCAAATGTTCCAACAGATTTCGGGTATCAACCTGATTACATAC
TACATCCCCGTTGTGCTGGAGAACCAGCTGGGTATGACCCTCGAAAACTCCCGCTTGATATCAGCTTGCAACGGG
ACGGAATACTTCCTCGCTTCATGGATTGCCGTGTTCACCATTGAGCACTTTGGTCGTCGGACACTGATGCTTTTT
GGCGCCGCGGGAATGTCAATATCGATGGTCATCCTTGCCGTCACCGCCAGCATCGGTAGTAACGGAGCCAATATC
GCCTGTATCGTCTTCCTGTTCGTTTTCAATACATTCTTCGCCATTGGCTGGCTGGGTATGACCTGGCTGTATCCG
GCTGAAGTGGTGCCGCTACGGATTCGTGCTCCGGCTAACGCGCTGGCAACGTCATCGAACTGGATCTTCAACTTC
CTGGTGGTCATGATCACGCCGGTGGCTTTTGACAACATTGGGTACCAGACCTACATCATCTTTGCGGTCATCAAC
GCCTTTATCTTCCCCGTAGTGCTCTTCTTCTATCCAGAGACGGCCCGCCGATCCCTGGAGGAAATGGATCGTATT
TTCCGCAAAACGACCAGTGTCTTCAACGTTGTCAAGGTTGCTAACGAGGAACCTCACATGTACGGCAAGCATGGT
GAGCTTCTGCGTACGCTCGATGACGTGGAAGACGATGCAGTCCGTCGCGCCAGTGTGCTGAGCCACCGGGCAAAG
GACATGGAGAAGGACAGTGACGAGAACACCAACAGCGTGAAGGCATAA
Transcript >Ani_SJS72_1|g309.t1
ATGGCGCGGTCATACTTGGGCCTCACAGGAGGCAAGCTGCAAATCGCTATCAGTGTCATCGCTGGTATGGATTTC
TTGCTGTTCGGTTACGATCAAGGTGTCACTGGTGGTCTGTTGACCCTCCAATCGTTCATCAAATACTTTCCAACT
ATCGCAACCAACGGTGAATACTATGAGAGCTTGACTAAAGCGCAACAAAGTACCCAGTCGACTCGCCAAGGTGTC
GTTGTCGCTGCGTACAACTTGGGCTGCTTTGCTGGATCGATTCCCACAATTTGGATTGGCAACATGCTCGGTCGG
CGCAAAACTATCTTCGTTGGTTCGTTTATTATGTGCATCGGAGCTTTGCTGCAATGCACTTCCTACCAACTCGGG
CAATTCATTGTTGGACGCTTGGTTACTGGTTTCGGAAACGGCATGAACACCTCTACCGTGCCCACCTGGCAGTCA
GAGTGCTGTAAATCCAACCATCGTGGAATGCTAGTCATGATTGAAGGTGCCATGATTACTTGCGGTATCACCATC
AGTTACTGGATTGATTTCGGTCTGCTATTCGCCGATCCAAATGAGGTGGCTTGGCGATTCCCGCTGGCCTTCCAG
ATTTTCTTCGCCCTCATTATCCTGGTTTTCGTTTTGCCTCTTCCCGAGTCGCCCCGTTGGCTAATCCTCAAGGGC
CGCGAGGACGAAGCAAGGACTGTCCTGCGGTCCCTCTTGGGCGACGCTGACGAGACCTTCATTGAGACGGAATTT
ACGGCCATCAAGGCTACAGTCTTGGAAATGGCCAAGGGTTCGTTCCGTGACATGTTCACCATGACCGAGGACCGC
CACTTCCACCGCGTGGTCTTAGCCTACGTCAATCAAATGTTCCAACAGATTTCGGGTATCAACCTGATTACATAC
TACATCCCCGTTGTGCTGGAGAACCAGCTGGGTATGACCCTCGAAAACTCCCGCTTGATATCAGCTTGCAACGGG
ACGGAATACTTCCTCGCTTCATGGATTGCCGTGTTCACCATTGAGCACTTTGGTCGTCGGACACTGATGCTTTTT
GGCGCCGCGGGAATGTCAATATCGATGGTCATCCTTGCCGTCACCGCCAGCATCGGTAGTAACGGAGCCAATATC
GCCTGTATCGTCTTCCTGTTCGTTTTCAATACATTCTTCGCCATTGGCTGGCTGGGTATGACCTGGCTGTATCCG
GCTGAAGTGGTGCCGCTACGGATTCGTGCTCCGGCTAACGCGCTGGCAACGTCATCGAACTGGATCTTCAACTTC
CTGGTGGTCATGATCACGCCGGTGGCTTTTGACAACATTGGGTACCAGACCTACATCATCTTTGCGGTCATCAAC
GCCTTTATCTTCCCCGTAGTGCTCTTCTTCTATCCAGAGACGGCCCGCCGATCCCTGGAGGAAATGGATCGTATT
TTCCGCAAAACGACCAGTGTCTTCAACGTTGTCAAGGTTGCTAACGAGGAACCTCACATGTACGGCAAGCATGGT
GAGCTTCTGCGTACGCTCGATGACGTGGAAGACGATGCAGTCCGTCGCGCCAGTGTGCTGAGCCACCGGGCAAAG
GACATGGAGAAGGACAGTGACGAGAACACCAACAGCGTGAAGGCATAA
Gene >Ani_SJS72_1|g309.t1
ATGGCGCGGTCATACTTGGGCCTCACAGGAGGCAAGCTGCAAATCGCTATCAGTGTCATCGCTGGTATGGATTTC
TTGCTGTTCGGTTACGATCAAGGTGTCACTGGTGGTCTGTTGACCCTCCAATCGTTCATCAAATACTTTCCAACT
ATCGCAACCAACGGTGAATACTATGAGAGCTTGACTAAAGCGCAACAAAGTACCCAGTCGACTCGCCAAGGTAAG
TGCACCATTTTGTGCTATGCTCTAATCATTGATTCAGCCCGCGGACTGATCTTTGTTTTTGTCAAGGTGTCGTTG
TCGCTGCGTACAACTTGGGCTGCTTTGCTGGATCGATTCCCACAATTTGGATTGGCAACATGCTCGGTCGGCGCA
AAACTATCTTCGTTGGTTCGTTTATTATGTGCATCGGAGCTTTGCTGCAATGCACTTCCTACCAACTCGGGCAAT
TCATTGTTGGACGCTTGGTTACTGGTTTCGGTAGGTGCAACGACGCCTTATGTCCAACTTGTGAGTTATGCAACT
TATGCAATACTAATCATATACTTTGTCGGTAGGAAACGGCATGAACACCTCTACCGTGCCCACCTGGCAGTCAGA
GTGCTGTAAATCCAACCATCGTGGAATGCTAGTCATGATTGAAGGTGCCATGATTACTTGCGGTATCACCATCAG
TTACTGGATTGATTTCGGTCTGCTATTCGCCGATCCAAATGAGGTGGCTTGGCGATTCCCGCTGGCCTTCCAGAT
TTTCTTCGCCCTCATTATCCTGGTTTTCGTTTTGCCTCTTCCCGAGTCGCCCCGTTGGCTAATCCTCAAGGGCCG
CGAGGACGAAGCAAGGACTGTCCTGCGGTCCCTCTTGGGCGACGCTGACGAGACCTTCATTGAGACGGAATTTAC
GGCCATCAAGGCTACAGTCTTGGAAATGGCCAAGGGTTCGTTCCGTGACATGTTCACCATGACCGAGGACCGCCA
CTTCCACCGCGTGGTCTTAGCCTACGTCAATCAAATGTTCCAACAGATTTCGGGTATCAACCTGATTACATACTA
CATCCCCGTTGTGCTGGAGAACCAGCTGGGTATGACCCTCGAAAACTCCCGCTTGATATCAGCTTGCAACGGGAC
GGAATACTTCCTCGCTTCATGGATTGCCGTGTTCACCATTGAGCACTTTGGTCGTCGGACACTGATGCTTTTTGG
CGCCGCGGGAATGTCAATATCGATGGTCATCCTTGCCGTCACCGCCAGCATCGGTAGTAACGGAGCCAATATCGC
CTGTATCGTCTTCCTGTTCGTTTTCAATACATTCTTCGCCATTGGCTGGCTGGGTATGACCTGGCTGTATCCGGC
TGAAGTGGTGCCGCTACGGATTCGTGCTCCGGCTAACGCGCTGGCAACGTCATCGAACTGGATCTTCAACTTCCT
GGTGGTCATGATCACGCCGGTGGCTTTTGACAACATTGGGTACCAGACCTACATCATCTTTGCGGTCATGTAAGT
TCCTCATCCCCTCGTTCACTCTCCATTTTCTGGCATCCTCAGTTCTAAACTTTGAACAGCAACGCCTTTATCTTC
CCCGTAGTGCTCTTCTTCTATCCAGAGACGGCCCGCCGATCCCTGGAGGAAATGGATCGTATTTTCCGCAAAACG
ACCAGTGTCTTCAACGTTGTCAAGGTTGCTAACGAGGAACCTCACATGTACGGCAAGCATGGTGAGCTTCTGCGT
ACGCTCGATGACGTGGAAGACGATGCAGTCCGTCGCGCCAGTGTGCTGAGCCACCGGGCAAAGGACATGGAGAAG
GACAGTGACGAGAACACCAACAGCGTGAAGGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail