Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g3043.t1
Gene name
Locationscaffold_016:303337..306693
Strand+
Gene length (bp)3356
Transcript length (bp)2988
Coding sequence length (bp)2988
Protein length (aa) 996

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01301 Glyco_hydro_35 Glycosyl hydrolases family 35 3.7E-86 34 370
PF13364 BetaGal_dom4_5 Beta-galactosidase jelly roll domain 1.2E-21 665 777
PF13364 BetaGal_dom4_5 Beta-galactosidase jelly roll domain 1.3E-33 833 945
PF10435 BetaGal_dom2 Beta-galactosidase, domain 2 1.8E-47 383 557
PF13363 BetaGal_dom3 Beta-galactosidase, domain 3 1.7E-24 558 632
PF02449 Glyco_hydro_42 Beta-galactosidase 9.8E-06 56 117

GO

GO Term Description Terminal node
GO:0009341 beta-galactosidase complex Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0004565 beta-galactosidase activity Yes
GO:0003824 catalytic activity No
GO:1902494 catalytic complex No
GO:0005575 cellular_component No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0015925 galactosidase activity No
GO:0016787 hydrolase activity No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0032991 protein-containing complex No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 23 0.999699

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH35 1.3E-89 35 370

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup7988
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g6513.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g7651.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g7131.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g6969.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g4950.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g4340.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g2792.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g5076.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g5590.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g2266.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g3222.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g9019.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g2927.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g6521.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g3508.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g3043.t1 (this protein)
Aspergillus niger CBS 147346 Ani_SJS75_1|g5378.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g5834.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g6350.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g7757.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g4249.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g4284.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g5812.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g1512.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g3043.t1
MKLQSILSCWAILVAQIWATTDGLTDLVAWDPYSLTVNGNRLFVYSGEFHYPRLPVPEMWLDVFQKMRAHGFNAV
SLYFFWDYHSPINGTYDFETGAHNIQRLFDYAQEAGIYIIARAGPYCNAEFNGGGLALYLSDGSGGELRTSDATY
HQAWTPWIERIGKIIAENSITNGGPVILNQIENELQETTHSASNTLVEYMEQIEEAFRAAGVDVPFTSNEKGQRS
RSWSTDYEDVGGAVNVYGLDSYPGGLSCTNPSTGFSVLRNYYQWFQNTSYTQPEYLPEFEGGWFSAWGADSFYDQ
CTSELSPQFADVYYKNIIGQRVTLQNLYMLYGGTNWGHLAAPVVYTSYDYSAPLRETRQIRDKLSQTKLVGLFTR
VSSGLLGVEMEGNGTSYTSTTSAYTWVLRNPNTTAGFYVVQQDTTSSQTDITFSLNVNTSAGAFTLPNINLQGRQ
SKVISTDYPLGHSTLLYVSTDIATYGTFGDTDVVVLYARSGQEVSFSFKNTTKLTFEEYGDSVNLTSSSGNRTIT
SYTYTQGSGTSVVKFSNGAIFYLVETETAFRFWAPPTTTDPYVTAEQQIFVLGPYLVRNVSISGSVVDLVGDNDN
ATTVEVFAGSSAKAVKWNGKEITVTKTDYGSLVGSIGGADSSSITIPSLTGWKVRDSLPEIQSSYDDSKWTVCNK
TTTLSPVDPLSLPVLFASDYGYYTGIKIYRGRFDGTNVTGANLTAQGGLAFGWNVWLNGDLVASLPGDADETSSN
AAIDFSNHTLKQTDNLLTVVIDYTGHDETSTGDGVENPRGLLGATLNGGSFTSWKIQGNAGGAAGAYELDPVRAP
MNEGGLLAERQGWHLPGYKAKSSDGWTDGSPLDGLNKSGVAFYLTTFTLDLPKNYDVPLGIQFTSPSTVDPVRIQ
LFINGYQYGKYVPYLGPQTTFPIPPGIINNRDKNTIGLSLWAQTDAGAKLENIELISYGAYESGFDAGNGTGFDL
NGAKLGYQPEWTEARAQYTR*
Coding >Ani_SJS72_1|g3043.t1
ATGAAGCTGCAGTCCATACTTTCATGCTGGGCGATTTTGGTCGCCCAAATTTGGGCGACTACAGATGGTCTGACA
GACCTGGTCGCCTGGGATCCTTACAGTCTGACTGTCAATGGCAATCGCCTGTTTGTCTATTCCGGAGAGTTCCAT
TATCCCCGATTGCCGGTTCCAGAAATGTGGCTTGATGTCTTTCAGAAGATGCGCGCACATGGCTTCAATGCTGTT
AGTCTGTATTTCTTCTGGGACTATCACTCTCCGATCAATGGAACATATGACTTTGAGACTGGAGCACACAACATT
CAGCGCTTATTCGACTATGCCCAAGAGGCCGGAATCTACATCATCGCACGTGCCGGACCATATTGTAATGCTGAG
TTTAACGGTGGTGGTCTAGCTTTATACCTCAGTGACGGGAGCGGTGGTGAGTTGCGAACAAGTGACGCGACATAC
CACCAAGCGTGGACACCCTGGATTGAGCGCATTGGGAAGATCATTGCGGAAAATTCCATTACCAACGGTGGACCA
GTCATCCTCAACCAGATCGAAAATGAACTTCAGGAGACCACACATTCTGCGAGCAATACCTTGGTCGAGTATATG
GAGCAGATCGAGGAGGCTTTCCGAGCTGCTGGCGTGGACGTTCCCTTCACTAGCAACGAAAAGGGCCAGCGATCT
CGAAGCTGGTCGACAGACTATGAGGATGTGGGTGGTGCGGTCAACGTCTATGGCCTAGACTCGTACCCGGGAGGG
CTCAGCTGCACCAACCCTTCAACGGGCTTTTCAGTCCTACGGAACTATTATCAGTGGTTCCAGAACACTAGCTAC
ACGCAGCCCGAATACTTGCCTGAGTTTGAAGGTGGCTGGTTCTCTGCCTGGGGCGCTGACTCGTTCTACGACCAG
TGCACAAGTGAGCTGAGTCCACAATTTGCGGACGTGTACTACAAGAACATTATTGGTCAACGGGTCACCCTCCAA
AACCTGTACATGCTGTACGGGGGAACTAACTGGGGCCATCTGGCTGCACCTGTGGTGTATACGTCGTACGACTAC
AGCGCTCCTCTCAGAGAGACCAGACAAATAAGGGACAAACTGAGCCAGACGAAGCTCGTTGGTCTGTTCACGCGA
GTGTCTTCTGGCCTGCTGGGAGTCGAAATGGAAGGGAATGGCACCTCCTACACATCTACCACCTCGGCATACACA
TGGGTGCTTCGGAACCCCAACACAACCGCTGGTTTCTATGTCGTACAGCAGGATACCACGTCCTCGCAGACAGAC
ATCACTTTCTCCCTGAACGTGAATACTTCTGCGGGCGCGTTTACCTTGCCCAACATCAATCTGCAAGGAAGGCAA
AGCAAGGTAATCTCGACTGATTACCCACTCGGTCACAGCACGCTCCTGTATGTATCAACTGACATCGCGACATAC
GGAACGTTTGGGGACACGGACGTTGTCGTGCTCTATGCGCGCTCCGGACAGGAGGTGTCCTTCTCCTTCAAGAAC
ACGACGAAGCTGACCTTCGAGGAATATGGTGACTCGGTGAACCTGACTAGCAGTTCAGGTAATCGCACCATTACC
TCATACACTTACACTCAAGGCAGTGGTACAAGCGTCGTGAAGTTCTCAAATGGCGCCATCTTCTATCTTGTGGAG
ACAGAAACGGCATTCCGATTCTGGGCGCCACCTACCACAACAGACCCCTATGTGACAGCGGAACAGCAAATATTC
GTGCTTGGGCCATACCTAGTCCGCAACGTCAGTATCTCCGGCAGCGTTGTGGATCTGGTTGGAGACAATGACAAT
GCCACCACTGTGGAAGTATTCGCCGGGTCTTCCGCGAAGGCCGTCAAATGGAACGGCAAGGAGATTACCGTCACG
AAGACAGACTATGGCAGTCTTGTGGGATCCATTGGTGGCGCCGATAGCAGCAGCATCACGATCCCAAGTTTGACA
GGATGGAAAGTTCGCGACTCCCTGCCAGAGATCCAGTCTTCCTATGATGACTCCAAGTGGACGGTGTGCAACAAG
ACAACTACCTTGAGTCCAGTCGATCCACTTAGCCTTCCTGTCTTGTTTGCGTCCGACTATGGCTACTACACAGGT
ATCAAGATCTATCGCGGTCGGTTCGATGGGACTAACGTGACTGGGGCAAACTTGACTGCGCAAGGAGGCCTGGCC
TTTGGTTGGAACGTCTGGCTAAATGGTGATCTTGTGGCCTCGCTCCCAGGTGATGCCGACGAAACGTCATCTAAC
GCGGCCATTGACTTTTCCAACCATACTTTGAAGCAGACCGATAATCTGCTGACTGTTGTGATCGACTACACCGGA
CATGACGAAACGTCTACCGGTGACGGCGTGGAAAACCCTAGAGGACTTCTCGGAGCAACGCTCAATGGCGGTTCT
TTCACAAGCTGGAAGATCCAAGGAAACGCTGGAGGTGCCGCTGGAGCATATGAGCTTGACCCTGTGAGAGCCCCC
ATGAATGAAGGTGGCTTGCTGGCCGAGCGTCAAGGTTGGCATCTTCCAGGATACAAGGCCAAGTCATCGGACGGC
TGGACGGACGGATCACCGCTTGATGGACTCAACAAGTCAGGGGTCGCCTTTTACCTTACCACCTTCACCCTTGAC
CTTCCCAAGAATTATGACGTTCCTCTGGGTATCCAATTTACTTCACCATCAACCGTCGACCCAGTGCGCATCCAG
CTCTTCATCAACGGATACCAATATGGCAAATATGTCCCATATCTAGGGCCGCAAACAACGTTCCCCATCCCACCT
GGTATCATTAACAACCGCGACAAGAACACCATTGGCCTTAGCTTATGGGCGCAGACGGATGCGGGAGCCAAGTTG
GAGAACATTGAGCTGATCAGCTATGGTGCGTATGAGAGTGGCTTCGATGCAGGCAATGGAACGGGTTTCGATCTA
AATGGAGCAAAATTGGGTTATCAGCCTGAGTGGACGGAAGCTCGGGCCCAGTACACCCGATGA
Transcript >Ani_SJS72_1|g3043.t1
ATGAAGCTGCAGTCCATACTTTCATGCTGGGCGATTTTGGTCGCCCAAATTTGGGCGACTACAGATGGTCTGACA
GACCTGGTCGCCTGGGATCCTTACAGTCTGACTGTCAATGGCAATCGCCTGTTTGTCTATTCCGGAGAGTTCCAT
TATCCCCGATTGCCGGTTCCAGAAATGTGGCTTGATGTCTTTCAGAAGATGCGCGCACATGGCTTCAATGCTGTT
AGTCTGTATTTCTTCTGGGACTATCACTCTCCGATCAATGGAACATATGACTTTGAGACTGGAGCACACAACATT
CAGCGCTTATTCGACTATGCCCAAGAGGCCGGAATCTACATCATCGCACGTGCCGGACCATATTGTAATGCTGAG
TTTAACGGTGGTGGTCTAGCTTTATACCTCAGTGACGGGAGCGGTGGTGAGTTGCGAACAAGTGACGCGACATAC
CACCAAGCGTGGACACCCTGGATTGAGCGCATTGGGAAGATCATTGCGGAAAATTCCATTACCAACGGTGGACCA
GTCATCCTCAACCAGATCGAAAATGAACTTCAGGAGACCACACATTCTGCGAGCAATACCTTGGTCGAGTATATG
GAGCAGATCGAGGAGGCTTTCCGAGCTGCTGGCGTGGACGTTCCCTTCACTAGCAACGAAAAGGGCCAGCGATCT
CGAAGCTGGTCGACAGACTATGAGGATGTGGGTGGTGCGGTCAACGTCTATGGCCTAGACTCGTACCCGGGAGGG
CTCAGCTGCACCAACCCTTCAACGGGCTTTTCAGTCCTACGGAACTATTATCAGTGGTTCCAGAACACTAGCTAC
ACGCAGCCCGAATACTTGCCTGAGTTTGAAGGTGGCTGGTTCTCTGCCTGGGGCGCTGACTCGTTCTACGACCAG
TGCACAAGTGAGCTGAGTCCACAATTTGCGGACGTGTACTACAAGAACATTATTGGTCAACGGGTCACCCTCCAA
AACCTGTACATGCTGTACGGGGGAACTAACTGGGGCCATCTGGCTGCACCTGTGGTGTATACGTCGTACGACTAC
AGCGCTCCTCTCAGAGAGACCAGACAAATAAGGGACAAACTGAGCCAGACGAAGCTCGTTGGTCTGTTCACGCGA
GTGTCTTCTGGCCTGCTGGGAGTCGAAATGGAAGGGAATGGCACCTCCTACACATCTACCACCTCGGCATACACA
TGGGTGCTTCGGAACCCCAACACAACCGCTGGTTTCTATGTCGTACAGCAGGATACCACGTCCTCGCAGACAGAC
ATCACTTTCTCCCTGAACGTGAATACTTCTGCGGGCGCGTTTACCTTGCCCAACATCAATCTGCAAGGAAGGCAA
AGCAAGGTAATCTCGACTGATTACCCACTCGGTCACAGCACGCTCCTGTATGTATCAACTGACATCGCGACATAC
GGAACGTTTGGGGACACGGACGTTGTCGTGCTCTATGCGCGCTCCGGACAGGAGGTGTCCTTCTCCTTCAAGAAC
ACGACGAAGCTGACCTTCGAGGAATATGGTGACTCGGTGAACCTGACTAGCAGTTCAGGTAATCGCACCATTACC
TCATACACTTACACTCAAGGCAGTGGTACAAGCGTCGTGAAGTTCTCAAATGGCGCCATCTTCTATCTTGTGGAG
ACAGAAACGGCATTCCGATTCTGGGCGCCACCTACCACAACAGACCCCTATGTGACAGCGGAACAGCAAATATTC
GTGCTTGGGCCATACCTAGTCCGCAACGTCAGTATCTCCGGCAGCGTTGTGGATCTGGTTGGAGACAATGACAAT
GCCACCACTGTGGAAGTATTCGCCGGGTCTTCCGCGAAGGCCGTCAAATGGAACGGCAAGGAGATTACCGTCACG
AAGACAGACTATGGCAGTCTTGTGGGATCCATTGGTGGCGCCGATAGCAGCAGCATCACGATCCCAAGTTTGACA
GGATGGAAAGTTCGCGACTCCCTGCCAGAGATCCAGTCTTCCTATGATGACTCCAAGTGGACGGTGTGCAACAAG
ACAACTACCTTGAGTCCAGTCGATCCACTTAGCCTTCCTGTCTTGTTTGCGTCCGACTATGGCTACTACACAGGT
ATCAAGATCTATCGCGGTCGGTTCGATGGGACTAACGTGACTGGGGCAAACTTGACTGCGCAAGGAGGCCTGGCC
TTTGGTTGGAACGTCTGGCTAAATGGTGATCTTGTGGCCTCGCTCCCAGGTGATGCCGACGAAACGTCATCTAAC
GCGGCCATTGACTTTTCCAACCATACTTTGAAGCAGACCGATAATCTGCTGACTGTTGTGATCGACTACACCGGA
CATGACGAAACGTCTACCGGTGACGGCGTGGAAAACCCTAGAGGACTTCTCGGAGCAACGCTCAATGGCGGTTCT
TTCACAAGCTGGAAGATCCAAGGAAACGCTGGAGGTGCCGCTGGAGCATATGAGCTTGACCCTGTGAGAGCCCCC
ATGAATGAAGGTGGCTTGCTGGCCGAGCGTCAAGGTTGGCATCTTCCAGGATACAAGGCCAAGTCATCGGACGGC
TGGACGGACGGATCACCGCTTGATGGACTCAACAAGTCAGGGGTCGCCTTTTACCTTACCACCTTCACCCTTGAC
CTTCCCAAGAATTATGACGTTCCTCTGGGTATCCAATTTACTTCACCATCAACCGTCGACCCAGTGCGCATCCAG
CTCTTCATCAACGGATACCAATATGGCAAATATGTCCCATATCTAGGGCCGCAAACAACGTTCCCCATCCCACCT
GGTATCATTAACAACCGCGACAAGAACACCATTGGCCTTAGCTTATGGGCGCAGACGGATGCGGGAGCCAAGTTG
GAGAACATTGAGCTGATCAGCTATGGTGCGTATGAGAGTGGCTTCGATGCAGGCAATGGAACGGGTTTCGATCTA
AATGGAGCAAAATTGGGTTATCAGCCTGAGTGGACGGAAGCTCGGGCCCAGTACACCCGATGA
Gene >Ani_SJS72_1|g3043.t1
ATGAAGCTGCAGTCCATACTTTCATGCTGGGCGATTTTGGTCGCCCAAATTTGGGCGACTACAGATGGTCTGACA
GACCTGGTCGCCTGGGATCCTTACAGTCTGACTGTCAATGGCAATCGCCTGTTTGTCTATTCCGGAGAGTTCCAT
TATCCCCGATTGCCGGTTCCAGAAATGTGGCTTGATGTCTTTCAGAAGATGCGCGCACATGGCTTCAATGCTGTT
AGGTTTGTGCAATATGATTGATGTCTCAATATTCTTTCAGGTCCCTAATTCCTGACGGTTGTCACATAGTCTGTA
TTTCTTCTGGGACTATCACTCTCCGATCAATGGAACATATGACTTTGAGACTGGAGCACACAACATTCAGCGCTT
ATTCGACTATGCCCAAGAGGCCGGAATCTACATCATCGCACGGTTCGTTATTGTGGTCCACCTGTCCCTCAGGAT
TTGCTGACATCATGCCAGTGCCGGACCATATTGTAATGCTGAGTTTAACGGTGGTGGTCTAGCTTTATACCTCAG
TGACGGGAGCGGTGGTGAGTTGCGAACAAGTGACGCGACATACCACCAAGCGTGGACACCCTGGATTGAGCGCAT
TGGGAAGATCATTGCGGAAAATTCCATTACCAACGGTGGACCAGTCATCCTCAACCAGATCGAAAATGAACTTCA
GGAGACCACACATTCTGCGAGCAATACCTTGGTCGAGTATATGGAGCAGATCGAGGAGGCTTTCCGAGCTGCTGG
CGTGGACGTTCCCTTCACTAGCAACGAAAAGGGCCAGCGATCTCGAAGCTGGTCGACAGACTATGAGGATGTGGG
TGGTGCGGTCAACGTCTATGGCCTAGACTCGTACCCGGGAGGGCTCAGCTGCACCAACCCTTCAACGGGCTTTTC
AGTCCTACGGAACTATTATCAGTGGTTCCAGAACACTAGCTACACGCAGCCCGAATACTTGCCTGAGTTTGAAGG
TGGCTGGTTCTCTGCCTGGGGCGCTGACTCGTTCTACGACCAGTGCACAAGTGAGCTGAGTCCACAATTTGCGGA
CGTGTACTACAAGAACATTATTGGTCAACGGGTCACCCTCCAAAACCTGTACATGCTGTACGGGGGAACTAACTG
GGGCCATCTGGCTGCACCTGTGGTGTATACGTCGTGTAAGTTCATTTGCTTGATTCCGCATACACAGCCGCCCTG
ACTAGCTGTAGACGACTACAGCGCTCCTCTCAGAGAGACCAGACAAATAAGGGACAAACTGAGCCAGACGAAGCT
CGTTGGTCTGTTCACGCGAGTGTCTTCTGGCCTGCTGGGAGTCGAAATGGAAGGGAATGGCACCTCCTACACATC
TACCACCTCGGCATACACATGGGTGCTTCGGAACCCCAACACAACCGCTGGTTTCTATGTCGTACAGCAGGATAC
CACGTCCTCGCAGACAGACATCACTTTCTCCCTGAACGTGAATACTTCTGCGGGCGCGTTTACCTTGCCCAACAT
CAATCTGCAAGGAAGGCAAAGCAAGGTAATCTCGACTGATTACCCACTCGGTCACAGCACGCTCCTGTATGTATC
AACTGACATCGCGACATACGGAACGTTTGGGGACACGGACGTTGTCGTGCTCTATGCGCGCTCCGGACAGGAGGT
GTCCTTCTCCTTCAAGAACACGACGAAGCTGACCTTCGAGGAATATGGTGACTCGGTGAACCTGACTAGCAGTTC
AGGTAATCGCACCATTACCTCATACACTTACACTCAAGGCAGTGGTACAAGCGTCGTGAAGTTCTCAAATGGCGC
CATCTTCTATCTTGTGGAGACAGAAACGGCATTCCGATTCTGGGCGCCACCTACCACAACAGACCCCTATGTGAC
AGCGGAACAGCAAATATTCGTGCTTGGGCCATACCTAGTCCGCAACGTCAGTATCTCCGGCAGCGTTGTGGATCT
GGTTGGAGACAATGACAATGCCACCACTGTGGAAGTATTCGCCGGGTCTTCCGCGAAGGCCGTCAAATGGAACGG
CAAGGAGATTACCGTCACGAAGACAGACTATGGCAGTCTTGTGGGATCCATTGGTGGCGCCGATAGCAGCAGCAT
CACGATCCCAAGTTTGACAGGATGGAAAGTTCGCGACTCCCTGCCAGAGATCCAGTCTTCCTATGATGACTCCAA
GTGGACGGTGTGCAACAAGACAACTACCTTGAGTCCAGTCGATCCACTTAGCCTTCCTGTCTTGTTTGCGTCCGA
CTATGGCTACTACACAGGTATCAAGATCTATCGCGGTCGGTTCGATGGGACTAACGTGACTGGGGCAAACTTGAC
TGCGCAAGGAGGCCTGGCCTTTGGTTGGAACGTCTGGCTAAATGGTGATCTTGTGGCCTCGCTCCCAGGTGATGC
CGACGAAACGTCATCTAACGCGGCCATTGACTTTTCCAACCATACTTTGAAGCAGACCGATAATCTGCTGACTGT
TGTGGTAAGTTAGCACGCAGGTACGCTAATCTAGAGAGACATAACTAACCAGCTCATCCAGATCGACTACACCGG
ACATGACGAAACGTCTACCGGTGACGGCGTGGAAAACCCTAGAGGACTTCTCGGAGCAACGCTCAATGGCGGTTC
TTTCACAAGCTGGAAGATCCAAGGAAACGCTGGAGGTGCCGCTGGTAAGAACTCCGTGGTCCCCTTTTCTCAATC
GTACTAGGCTAAGAAGATTGTTCACTTCGTGACAATAGGAGCATATGAGCTTGACCCTGTGAGAGCCCCCATGAA
TGAAGGTGGCTTGCTGGCCGAGCGTCAAGGTTGGCATCTTCCAGGATACAAGGCCAAGTCATCGGACGGCTGGAC
GGACGGATCACCGCTTGATGGACTCAACAAGTCAGGTATGGATCAGTGTCATTCTCACCCACACCTACTCGCTGC
TCGTTGTTGTCCATGTCTAATCCAGAGTAACAGGGGTCGCCTTTTACCTTACCACCTTCACCCTTGACCTTCCCA
AGAATTATGACGTTCCTCTGGGTATCCAATTTACTTCACCATCAACCGTCGACCCAGTGCGCATCCAGCTCTTCA
TCAACGGATACCAATATGGCAAATATGTCCCATATCTAGGGCCGCAAACAACGTTCCCCATCCCACCTGGTATCA
TTAACAACCGCGACAAGAACACCATTGGCCTTAGCTTATGGGCGCAGACGGATGCGGGAGCCAAGTTGGAGAACA
TTGAGCTGATCAGCTATGGTGCGTATGAGAGTGGCTTCGATGCAGGCAATGGAACGGGTTTCGATCTAAATGGAG
CAAAATTGGGTTATCAGCCTGAGTGGACGGAAGCTCGGGCCCAGTACACCCGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail