Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g3041.t1
Gene name
Locationscaffold_016:297961..300049
Strand+
Gene length (bp)2088
Transcript length (bp)1908
Coding sequence length (bp)1908
Protein length (aa) 636

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 6.5E-91 125 579
PF07690 MFS_1 Major Facilitator Superfamily 9.7E-17 127 528

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

Domain # Start End Length
1 166 185 19
2 198 220 22
3 259 281 22
4 382 404 22
5 414 436 22
6 443 465 22
7 515 537 22
8 544 563 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g3041.t1
MEGEGVTAKAVQKDENPASVEHAEKPQQRHDVLDIEGRSGGLNAVFENPLAGVPREQLLNDVERFCRQYGLEAHL
DDFRKGALISQNPQGALDLPELTEADKEILRREQTHKWSQPWQLYFMASMCSLAAAVQGMDETVNNGAQAIYLDE
LGITAPRFSDQMQDYLTGLVVGAPYLACAILGCWLTEPMNRYLARRGTIFWSCFIAAVASIWEGVANSWVNLFIA
RFVLGLGIGSKSSTVPVYAAECSPAPIRGALVMMWQMWTAFGIMLGNIMGVAFMGVSRDLSWRLMLGSTVVLPLV
VCAQVYFCPESPRWLIQHNRINKAFESFRTLRPSDLQAARDLYYAYVQVELERKVNTGKNFFSMFLELFTVPRNR
RATLASWIVMFLQQFCGVNVIAYYSTTIFQDSGYSIQEALLASMGTGILNWVFALPAFFTIDTWGRRNLLLFTFP
FLAIWLLWTGFSFWIEPWNETSKKRVGMVTTGLYLFEVFYSPGEGPVPFTYSAEAFPLQVREVGMSWATATTWCF
NFILSFTWPMLLRAFKPQGAFGWYAAWCVIGWFLVLLFVPETKELTLEELDQVFSVSMRKHASYQLKNAWWHFRV
WVLRQKLEPLPKFYEHAENLAEGHAENHSQEYNEK*
Coding >Ani_SJS72_1|g3041.t1
ATGGAAGGAGAAGGGGTCACGGCAAAGGCCGTACAGAAGGACGAAAACCCTGCCAGCGTTGAGCACGCGGAAAAA
CCGCAGCAGCGACACGATGTCTTGGATATCGAAGGGCGATCGGGCGGTCTTAATGCCGTGTTTGAGAACCCACTA
GCAGGTGTTCCTCGGGAGCAACTCCTCAACGACGTAGAGCGCTTTTGTCGCCAGTACGGTCTCGAAGCTCACTTG
GACGATTTTCGTAAAGGCGCCCTCATTTCACAGAACCCGCAAGGCGCATTGGACCTCCCCGAATTGACCGAGGCA
GACAAGGAGATCCTCCGGCGGGAACAGACGCATAAATGGTCGCAGCCCTGGCAGCTCTACTTCATGGCCTCCATG
TGCTCTCTCGCAGCCGCTGTACAGGGTATGGATGAGACCGTCAACAATGGCGCCCAAGCCATCTATCTCGATGAA
CTTGGGATTACTGCTCCTCGCTTTTCAGACCAAATGCAAGATTATCTTACTGGGCTCGTCGTTGGCGCTCCCTAT
CTAGCGTGTGCTATTCTCGGCTGCTGGCTCACCGAGCCCATGAACAGGTACCTGGCGCGACGGGGGACGATTTTC
TGGTCTTGCTTCATCGCGGCAGTAGCTTCCATCTGGGAAGGCGTGGCTAATTCCTGGGTTAACCTCTTCATCGCA
CGGTTTGTCCTCGGTCTTGGAATCGGTTCCAAATCGTCTACCGTGCCTGTCTATGCGGCTGAATGCTCCCCGGCC
CCCATCCGAGGTGCCCTTGTGATGATGTGGCAGATGTGGACAGCATTTGGCATCATGCTTGGTAATATCATGGGC
GTTGCTTTCATGGGCGTGTCGAGGGATCTTTCCTGGCGTCTTATGCTCGGATCAACCGTGGTCCTGCCCCTCGTC
GTCTGCGCGCAAGTCTACTTCTGCCCGGAGTCCCCTCGATGGCTTATCCAGCATAACCGAATCAACAAGGCCTTC
GAGTCTTTCCGCACTCTCCGCCCGTCAGATCTGCAGGCGGCCCGAGACTTGTACTACGCGTACGTCCAGGTGGAG
CTGGAGCGGAAAGTCAACACCGGGAAGAACTTCTTCTCCATGTTCCTCGAGCTCTTTACGGTCCCACGCAATCGT
CGCGCCACGCTTGCTAGCTGGATTGTCATGTTTCTCCAACAATTCTGTGGAGTCAACGTCATTGCTTACTACAGC
ACAACCATATTTCAAGATTCCGGATATAGTATCCAGGAAGCCCTATTGGCCAGTATGGGAACCGGTATCCTGAAT
TGGGTTTTTGCGCTCCCCGCATTTTTCACCATTGACACATGGGGCCGTCGAAATCTTCTGCTCTTTACATTTCCA
TTTTTAGCCATCTGGCTTCTCTGGACGGGGTTCTCATTCTGGATTGAACCGTGGAACGAAACCAGTAAGAAGCGG
GTGGGAATGGTCACGACGGGCTTATATCTATTCGAGGTATTCTATTCCCCCGGTGAGGGACCCGTGCCATTTACC
TATTCTGCCGAAGCATTTCCACTGCAGGTACGTGAGGTTGGCATGTCATGGGCCACCGCGACAACTTGGTGTTTC
AACTTTATCCTGTCATTCACCTGGCCTATGCTCCTCAGAGCGTTCAAGCCTCAGGGTGCGTTTGGATGGTATGCC
GCGTGGTGTGTGATTGGATGGTTTTTGGTTCTTCTGTTTGTGCCAGAGACTAAAGAACTTACACTTGAAGAACTT
GACCAAGTTTTTTCGGTCTCGATGCGCAAGCATGCATCCTACCAATTGAAGAATGCATGGTGGCATTTCCGTGTC
TGGGTGCTCCGGCAGAAGTTGGAACCACTGCCCAAATTCTATGAGCATGCGGAGAACCTGGCTGAAGGGCACGCG
GAGAACCACTCGCAGGAATATAATGAGAAATGA
Transcript >Ani_SJS72_1|g3041.t1
ATGGAAGGAGAAGGGGTCACGGCAAAGGCCGTACAGAAGGACGAAAACCCTGCCAGCGTTGAGCACGCGGAAAAA
CCGCAGCAGCGACACGATGTCTTGGATATCGAAGGGCGATCGGGCGGTCTTAATGCCGTGTTTGAGAACCCACTA
GCAGGTGTTCCTCGGGAGCAACTCCTCAACGACGTAGAGCGCTTTTGTCGCCAGTACGGTCTCGAAGCTCACTTG
GACGATTTTCGTAAAGGCGCCCTCATTTCACAGAACCCGCAAGGCGCATTGGACCTCCCCGAATTGACCGAGGCA
GACAAGGAGATCCTCCGGCGGGAACAGACGCATAAATGGTCGCAGCCCTGGCAGCTCTACTTCATGGCCTCCATG
TGCTCTCTCGCAGCCGCTGTACAGGGTATGGATGAGACCGTCAACAATGGCGCCCAAGCCATCTATCTCGATGAA
CTTGGGATTACTGCTCCTCGCTTTTCAGACCAAATGCAAGATTATCTTACTGGGCTCGTCGTTGGCGCTCCCTAT
CTAGCGTGTGCTATTCTCGGCTGCTGGCTCACCGAGCCCATGAACAGGTACCTGGCGCGACGGGGGACGATTTTC
TGGTCTTGCTTCATCGCGGCAGTAGCTTCCATCTGGGAAGGCGTGGCTAATTCCTGGGTTAACCTCTTCATCGCA
CGGTTTGTCCTCGGTCTTGGAATCGGTTCCAAATCGTCTACCGTGCCTGTCTATGCGGCTGAATGCTCCCCGGCC
CCCATCCGAGGTGCCCTTGTGATGATGTGGCAGATGTGGACAGCATTTGGCATCATGCTTGGTAATATCATGGGC
GTTGCTTTCATGGGCGTGTCGAGGGATCTTTCCTGGCGTCTTATGCTCGGATCAACCGTGGTCCTGCCCCTCGTC
GTCTGCGCGCAAGTCTACTTCTGCCCGGAGTCCCCTCGATGGCTTATCCAGCATAACCGAATCAACAAGGCCTTC
GAGTCTTTCCGCACTCTCCGCCCGTCAGATCTGCAGGCGGCCCGAGACTTGTACTACGCGTACGTCCAGGTGGAG
CTGGAGCGGAAAGTCAACACCGGGAAGAACTTCTTCTCCATGTTCCTCGAGCTCTTTACGGTCCCACGCAATCGT
CGCGCCACGCTTGCTAGCTGGATTGTCATGTTTCTCCAACAATTCTGTGGAGTCAACGTCATTGCTTACTACAGC
ACAACCATATTTCAAGATTCCGGATATAGTATCCAGGAAGCCCTATTGGCCAGTATGGGAACCGGTATCCTGAAT
TGGGTTTTTGCGCTCCCCGCATTTTTCACCATTGACACATGGGGCCGTCGAAATCTTCTGCTCTTTACATTTCCA
TTTTTAGCCATCTGGCTTCTCTGGACGGGGTTCTCATTCTGGATTGAACCGTGGAACGAAACCAGTAAGAAGCGG
GTGGGAATGGTCACGACGGGCTTATATCTATTCGAGGTATTCTATTCCCCCGGTGAGGGACCCGTGCCATTTACC
TATTCTGCCGAAGCATTTCCACTGCAGGTACGTGAGGTTGGCATGTCATGGGCCACCGCGACAACTTGGTGTTTC
AACTTTATCCTGTCATTCACCTGGCCTATGCTCCTCAGAGCGTTCAAGCCTCAGGGTGCGTTTGGATGGTATGCC
GCGTGGTGTGTGATTGGATGGTTTTTGGTTCTTCTGTTTGTGCCAGAGACTAAAGAACTTACACTTGAAGAACTT
GACCAAGTTTTTTCGGTCTCGATGCGCAAGCATGCATCCTACCAATTGAAGAATGCATGGTGGCATTTCCGTGTC
TGGGTGCTCCGGCAGAAGTTGGAACCACTGCCCAAATTCTATGAGCATGCGGAGAACCTGGCTGAAGGGCACGCG
GAGAACCACTCGCAGGAATATAATGAGAAATGA
Gene >Ani_SJS72_1|g3041.t1
ATGGAAGGAGAAGGGGTCACGGCAAAGGCCGTACAGAAGGACGAAAACCCTGCCAGCGTTGAGCACGCGGAAAAA
CCGCAGCAGCGACACGATGTCTTGGATATCGAAGGGCGATCGGGCGGTCTTAATGCCGTGTTTGAGAACCCACTA
GCAGGTGTTCCTCGGGAGCAACTCCTCAACGACGTAGAGCGCTTTTGTCGCCAGTACGGTCTCGAAGCTCACTTG
GACGATTTTCGTAAAGGCGCCCTCATTTCACAGAACCCGCAAGGCGCATTGGACCTCCCCGAATTGACCGAGGCA
GACAAGGAGATCCTCCGGCGGGAACAGACGCATAAATGGTCGCAGCCCTGGCAGCTCTACTTCATGGCCTGTAAG
TGGTTTTCCCCGGTACTATCCATCATGGCATTTCCCTGTCCCGGTGCTGACGGTGCTTCTATCAAGCCATGTGCT
CTCTCGCAGCCGCTGTACAGGGTATGGATGAGACCGTCAACAATGGCGCCCAAGCCATCTATCTCGATGTAAGTG
CTCCCTCGCCTTTACGCTCAAGCGGCCCGTGCTAACAACAAGCAAGGAACTTGGGATTACTGCTCCTCGCTTTTC
AGACCAAATGCAAGATTATCTTACTGGGCTCGTCGTTGGCGCTCCCTATCTAGCGTGTGCTATTCTCGGCTGCTG
GCTCACCGAGCCCATGAACAGGTACCTGGCGCGACGGGGGACGATTTTCTGGTCTTGCTTCATCGCGGCAGTAGC
TTCCATCTGGGAAGGCGTGGCTAATTCCTGGGTTAACCTCTTCATCGCACGGTTTGTCCTCGGTCTTGGAATCGG
TTCCAAATCGTCTACCGTGCCTGTCTATGCGGCTGAATGCTCCCCGGCCCCCATCCGAGGTGCCCTTGTGATGAT
GTGGCAGATGTGGACAGCATTTGGCATCATGCTTGGTAATATCATGGGCGTTGCTTTCATGGGCGTGTCGAGGGA
TCTTTCCTGGCGTCTTATGCTCGGATCAACCGTGGTCCTGCCCCTCGTCGTCTGCGCGCAAGTCTACTTCTGCCC
GGAGTCCCCTCGATGGCTTATCCAGCATAACCGAATCAACAAGGCCTTCGAGTCTTTCCGCACTCTCCGCCCGTC
AGATCTGCAGGCGGCCCGAGACTTGTACTACGCGTACGTCCAGGTGGAGCTGGAGCGGAAAGTCAACACCGGGAA
GAACTTCTTCTCCATGTTCCTCGAGCTCTTTACGGTCCCACGCAATCGTCGCGCCACGCTTGCTAGCTGGATTGT
CATGTTTCTCCAACAATTCTGTGGAGTCAACGTCATTGCTTACTACAGCACAACCATATTTCAAGATTCCGGATA
TAGTATCCAGGAAGCCCTATTGGCCAGTATGGGAACCGGTATCCTGAATTGGGTTTTTGCGCTCCCCGCATTTTT
CACCATTGACACATGGGGCCGTCGAAATCTTCTGCTCTTTACATTTCCATTTTTAGCCATCTGGCTTCTCTGGAC
GGGGTTCTCATTCTGGATTGAACCGTGGAACGAAACCAGTAAGAAGCGGGTGGGAATGGTCACGACGGGCTTATA
TCTATTCGAGGTATTCTATTCCCCCGGTGAGGGACCCGTGCCATTTACCTATTCTGCCGAAGCATTTCCACTGCA
GGTACGTGAGGTTGGCATGTCATGGGCCACCGCGACAACTTGGTGTTTCAACTTTATCCTGTCATTCACCTGGCC
TATGCTCCTCAGAGCGTTCAAGCCTCAGGGTGCGTTTGGATGGTATGCCGCGTGGTGTGTGATTGGATGGTTTTT
GGTTCTTCTGTTTGTGCCAGAGACTAAAGGTAAGTGTTGGGTTTCGCCATCAAAGCTCAGGGGTAAAGCTAACGA
CATTTGATAGAACTTACACTTGAAGAACTTGACCAAGTTTTTTCGGTCTCGATGCGCAAGCATGCATCCTACCAA
TTGAAGAATGCATGGTGGCATTTCCGTGTCTGGGTGCTCCGGCAGAAGTTGGAACCACTGCCCAAATTCTATGAG
CATGCGGAGAACCTGGCTGAAGGGCACGCGGAGAACCACTCGCAGGAATATAATGAGAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail