Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g292.t1
Gene name
Locationscaffold_001:836453..838990
Strand-
Gene length (bp)2537
Transcript length (bp)1365
Coding sequence length (bp)1365
Protein length (aa) 455

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09335 SNARE_assoc SNARE associated Golgi protein 2.7E-10 146 255

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 86 108 22
2 123 145 22
3 158 180 22
4 232 254 22
5 274 296 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g292.t1
MPADYSSTARALSVSTSSPEPLSPSEDEAYPPWSRRAPGRRNSASISGGRSATLRDQIIDRATKTYHQILESWRK
MNFWQRVGAVAAFLLANLLGIGFLVFTGKVFIWLQPVAAQWEHSPLAYGVLWLCVFFVSFPPLVGWSTFGTMAGY
IFGIWKGWLLYASATVLGSTCSFIVSRTILSKFVHRLMERDKRFAALSLTLKYDGLKLLCMIRLCPLPYSVCNGA
VSTFPTVQPLMYGLATALISPKLLVPAFIGNRLRVLSENNEEMSAGSKAVNICSIIVSICIGIFTGLYIYRRTLA
RAKELEAKEREDIRRSLQADHAAHRPHDAFSEDPEVNSAAALLARDEEERIGFGDLDDDHVDLAIDDESGSETSP
HRTQASPYRDEFTDNDSDVFKDGDGTHEEMRRYSLPAGEGPVVLLATNSIPAYKIHFTSLVQALSSPVQWTDRDG
ARHG*
Coding >Ani_SJS72_1|g292.t1
ATGCCAGCGGATTACTCATCCACCGCCCGGGCACTGTCCGTCTCGACCTCATCCCCAGAACCTCTGTCTCCGTCG
GAGGATGAGGCTTATCCACCATGGAGCCGAAGAGCACCGGGGAGGCGAAATTCAGCCAGTATCTCCGGCGGACGA
TCCGCTACCCTCCGAGATCAAATCATAGACCGAGCAACCAAGACATACCACCAGATCCTGGAATCGTGGCGCAAG
ATGAACTTCTGGCAAAGGGTAGGGGCGGTGGCCGCGTTCTTACTGGCCAATCTCCTTGGAATCGGCTTTCTTGTC
TTCACCGGGAAGGTCTTCATTTGGCTTCAACCTGTGGCGGCACAATGGGAGCATTCTCCTCTAGCCTACGGGGTT
TTGTGGTTGTGTGTTTTCTTTGTCTCCTTTCCGCCGTTGGTTGGATGGTCCACATTTGGAACTATGGCGGGCTAC
ATCTTTGGGATATGGAAAGGATGGCTTCTTTATGCTTCCGCAACTGTGCTTGGGTCGACTTGTTCTTTCATTGTG
TCTCGGACAATCCTATCCAAATTCGTCCACCGGTTGATGGAACGCGATAAGAGATTTGCAGCTTTGTCGTTGACG
TTGAAGTATGACGGTTTGAAATTGCTGTGTATGATCCGCCTCTGCCCGCTGCCCTACTCGGTATGCAATGGGGCG
GTCTCAACCTTCCCCACGGTTCAGCCGTTGATGTATGGGCTTGCCACAGCACTCATTTCGCCGAAGCTGCTGGTT
CCAGCCTTCATCGGCAACCGGTTACGCGTCTTGTCGGAGAACAATGAAGAGATGAGTGCAGGCTCCAAGGCTGTC
AATATTTGCAGCATCATCGTCTCCATTTGCATCGGTATCTTCACGGGATTGTATATATATAGAAGAACATTGGCC
CGGGCCAAAGAGCTAGAGGCGAAAGAAAGGGAGGACATCCGACGCTCGCTGCAAGCTGACCATGCTGCCCATCGT
CCCCATGACGCCTTTTCCGAGGATCCTGAAGTCAACAGTGCGGCCGCTCTTCTTGCGCGCGATGAAGAGGAACGC
ATCGGATTCGGCGACCTCGACGACGACCACGTCGACCTGGCGATTGACGATGAGAGTGGCAGTGAGACCTCCCCC
CACCGTACACAAGCCTCCCCTTATCGCGATGAGTTTACCGACAACGATTCAGATGTCTTCAAGGATGGAGATGGG
ACCCATGAGGAAATGCGGCGGTATTCTCTTCCTGCCGGCGAAGGACCTGTTGTCCTGTTAGCCACTAACTCCATC
CCGGCATATAAGATACATTTCACATCCCTGGTCCAGGCCTTATCTTCACCCGTCCAATGGACTGATCGTGATGGA
GCTCGCCATGGATGA
Transcript >Ani_SJS72_1|g292.t1
ATGCCAGCGGATTACTCATCCACCGCCCGGGCACTGTCCGTCTCGACCTCATCCCCAGAACCTCTGTCTCCGTCG
GAGGATGAGGCTTATCCACCATGGAGCCGAAGAGCACCGGGGAGGCGAAATTCAGCCAGTATCTCCGGCGGACGA
TCCGCTACCCTCCGAGATCAAATCATAGACCGAGCAACCAAGACATACCACCAGATCCTGGAATCGTGGCGCAAG
ATGAACTTCTGGCAAAGGGTAGGGGCGGTGGCCGCGTTCTTACTGGCCAATCTCCTTGGAATCGGCTTTCTTGTC
TTCACCGGGAAGGTCTTCATTTGGCTTCAACCTGTGGCGGCACAATGGGAGCATTCTCCTCTAGCCTACGGGGTT
TTGTGGTTGTGTGTTTTCTTTGTCTCCTTTCCGCCGTTGGTTGGATGGTCCACATTTGGAACTATGGCGGGCTAC
ATCTTTGGGATATGGAAAGGATGGCTTCTTTATGCTTCCGCAACTGTGCTTGGGTCGACTTGTTCTTTCATTGTG
TCTCGGACAATCCTATCCAAATTCGTCCACCGGTTGATGGAACGCGATAAGAGATTTGCAGCTTTGTCGTTGACG
TTGAAGTATGACGGTTTGAAATTGCTGTGTATGATCCGCCTCTGCCCGCTGCCCTACTCGGTATGCAATGGGGCG
GTCTCAACCTTCCCCACGGTTCAGCCGTTGATGTATGGGCTTGCCACAGCACTCATTTCGCCGAAGCTGCTGGTT
CCAGCCTTCATCGGCAACCGGTTACGCGTCTTGTCGGAGAACAATGAAGAGATGAGTGCAGGCTCCAAGGCTGTC
AATATTTGCAGCATCATCGTCTCCATTTGCATCGGTATCTTCACGGGATTGTATATATATAGAAGAACATTGGCC
CGGGCCAAAGAGCTAGAGGCGAAAGAAAGGGAGGACATCCGACGCTCGCTGCAAGCTGACCATGCTGCCCATCGT
CCCCATGACGCCTTTTCCGAGGATCCTGAAGTCAACAGTGCGGCCGCTCTTCTTGCGCGCGATGAAGAGGAACGC
ATCGGATTCGGCGACCTCGACGACGACCACGTCGACCTGGCGATTGACGATGAGAGTGGCAGTGAGACCTCCCCC
CACCGTACACAAGCCTCCCCTTATCGCGATGAGTTTACCGACAACGATTCAGATGTCTTCAAGGATGGAGATGGG
ACCCATGAGGAAATGCGGCGGTATTCTCTTCCTGCCGGCGAAGGACCTGTTGTCCTGTTAGCCACTAACTCCATC
CCGGCATATAAGATACATTTCACATCCCTGGTCCAGGCCTTATCTTCACCCGTCCAATGGACTGATCGTGATGGA
GCTCGCCATGGATGA
Gene >Ani_SJS72_1|g292.t1
ATGCCAGCGGATTACTCATCCACCGCCCGGGCACTGTCCGTCTCGACCTCATCCCCAGAACCTCTGTCTCCGTCG
GAGGATGAGGCTTATCCACCATGGAGCCGAAGAGCACCGGGGAGGCGAAATTCAGCCAGTATCTCCGGCGGACGA
TCCGCTACCCTCCGAGATCAAATCATAGACCGAGCAACCAAGACATACCACCAGATCCTGGAATCGTGGCGCAAG
ATGAACTTCTGGCAAAGGGTAGGGGCGGTGGCCGCGTTCTTACTGGCCAATCTCCTTGGAATCGGCTTTCTTGTC
TTCACCGGGAAGGTCTTCATTTGGCTTCAACCTGTGGCGGCACAATGGGAGCATTCTCCTCTAGCCTACGGGGTT
TTGTGGTTGTGTGTTTTCTTTGTCTCCTTTCCGCCGTTGGTTGGATGGTCCACATTTGGAACTATGGCGGGCTAC
ATCTTTGGGATATGGAAAGGGTGAGTTGAGAATTTTCATGGGTGCGCAAGAGGGCTAACCCCGTTCATAGATGGC
TTCTTTATGCTTCCGCAACTGTGCTTGGGTCGACTTGTTCTTTCATTGTGTCTCGGACAATCCTATCCAAATTCG
TCCACCGGTTGATGGAACGCGATAAGAGATTTGCAGCTTTGTCGTTGACGTTGAAGTATGACGGTTTGAAATTGC
TGTGTATGATCCGCCTCTGCCCGCTGCCCTACTCGGTATGCAATGGGGCGGTCTCAACCTTCCCCACGGTTCAGC
CGTTGATGTATGGGCTTGCCACAGCACTCATTTCGCCGAAGCTGCTGGTTCCAGCCTTCATCGGCAACCGGTTAC
GCGTCTTGTCGGAGAACAATGAAGAGATGAGTGCAGGCTCCAAGGCTGTCAATATTTGCAGCATCATCGTCTCCA
TTTGCATCGGTATCTTCACGGGATTGTATATATATAGAAGGTAAGAGTCAAGATATCTCCTTGCATTGTCCCGAT
ATCCGAGACTAACGCAATTCAACAAGAACATTGGCCCGGGCCAAAGAGCTAGAGGCGAAAGAAAGGGAGGACATC
CGACGCTCGCTGCAAGCTGACCATGCTGCCCATCGTCCCCATGACGCCTTTTCCGAGGATCCTGAAGTCAACAGT
GCGGCCGCTCTTCTTGCGCGCGATGAAGAGGAACGCATCGGATTCGGCGACCTCGACGACGACCACGTCGACCTG
GCGATTGACGATGAGAGTGGCAGTGAGACCTCCCCCCACCGTACACAAGCCTCCCCTTATCGCGATGAGTTTACC
GACAACGATTCAGATGTCTTCAAGGATGGAGATGGGACCCATGAGGAAATGTATACCCTACATACACACGTGCGG
AGACCCTAGGGCTCATAGTCGGCCCGGGACAGTCAATGGCGAGGGTGTTGGTGGCTACGTGATAGAAATCTGCGG
TTACGAGTGATGACAGCACACTTTCCGGGTGGACATGACGGTTTGTAAATTCCCTTGGGGGGTTTCGTAAATATT
ATAATTGGGCGAGGGGCCATAGGAGCCCGGCTTCTGGCTATGCCTCTAGACTGTTGAACACCAGGCTGTGTTAGT
CCTTGTATAAAGTAACTTTAGAATCTCTGCAGGTAGGTCTACTGATCAGGAAGGCAATCCTCAGATACTACTAAA
GACCTCGTCCTGTAAGTCACCGGCGTGGACTGGAATATTGAGACGGTGGTGACGAGTGCAACGTCCCAAGAAGTG
TGAGGTCCACCTTGAGCGCTGGTGTTGCGGGAGGATCCGGGAGCGTTGAGCAAGGCTGAGAGGGGCAATGGTCAG
ACCGCAAAAGCAGCATCTCGCGGAGGTGCTCTTAGCCAGATTTGACTGGCTTAAGAGAAGACTTGGAAAAGCAAA
GAAAGGGGGAGATGGACACGAAGTCAGTCTTCAGGCTGACGATAGCACACGAAGACGGCCAGCAGGAATGTAACG
AAAGCAATGAAAGTATTGGCCGGTCGGACTGAAAATTACGCGGGGTTCCGGCCGAATTTCCCGCCGACTTTCTTT
CCCTTTTCGAGTCCGACAGCCTCAAGGCAAGATTGTCCGTCTACTTTGAACTGACTCCCTTCGGCCTCTGCATCG
TGTCTCTTCCCCCCATCCCTTGATTCGTTGTCTCCATATTCCACTCCTCAGGCGGCGGTATTCTCTTCCTGCCGG
TAAGTCGGTCGCTACCTACTCCGTACCACTCAGATCCCCCTGCGGTTTCCTTGTCCTGCTACTAGTAGGGTTTGC
GCCGCTGCCAGAAACAAGCCAACCAACGTGATGGATTCGCAGGCGAAGGACCTGTTGTCCTGTTAGCCACTAACT
CCATCCCGGCATGTATGTCAACTGGTCATTCCCTGCGTCAGGCTCATTCATACTTGTCTTGGACTTTCCCCAGTG
TTCCCCCGCAAATCATATATGATATCGAGTGGTCCGCTGACCTTGAATTGAAAGATAAGATACATTTCACATCCC
TGGTCCAGGCCTTATCTTCACCCGTCCAATGGACTGATCGTGATGGAGCTCGCCATGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail