Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g2655.t1
Gene name
Locationscaffold_014:10330..14239
Strand-
Gene length (bp)3909
Transcript length (bp)3909
Coding sequence length (bp)3909
Protein length (aa) 1303

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01841 Transglut_core Transglutaminase-like superfamily 5.8E-10 827 926
PF07653 SH3_2 Variant SH3 domain 3.7E-06 15 70
PF00018 SH3_1 SH3 domain 4.3E-06 17 65

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup5640
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g7367.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g3780.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g1503.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g1546.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g8696.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g329.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g2668.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g7424.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g5802.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g7194.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g8774.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g575.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g2339.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g2712.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g4769.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g2655.t1 (this protein)
Aspergillus niger CBS 147346 Ani_SJS75_1|g4894.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g527.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g5817.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g537.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g6067.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g2868.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g1739.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g721.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g2655.t1
MAPAAPQLPTRFPCWCRAIYSWGGETKRDLGFVEGDLIECLNAGDGQWWMGRLRRDRRMMGLFPSNFVEVLREDF
VPVQRSTSPMLPPASSPITNPTSAPKKQKTVFRKPFQAHKEALAPSGELSRSSTSSSPVTSTIPQTPPRDGSLSS
RKVKPLRTPTTAVKHQSSLSRPVSRSRPLSRAMSPHPPAEPDPQFSSTLPGTYMARSRPPSRGVSPIPPDPELHL
PSMPSVQSAPRPGPAPRAVSPAPPPTIDYQLPSLPPMEVAIQRPASRAVSPYPPDDQDLMPPQVPRHSISLHRPS
SREISPLQLHEREDSPPPPPPPPHRVAVNRQPSIEPHVPTRLDMNDRFVTISRTPSPAAHSEGRGHTPSPLRDAM
EDVMTSLEDMGLPRGGQSPSPQPMFNNPWSPDAYDSFRETRPAQTSRRPLTSLGFDGDKEYQYHGSQTHRNSVYA
HDPYMDGPPQLNNYVQRMESRLRQMQEQSQREAEEDAQPSDEEEAPPPPPRNVPYHARHNSIPAQYPLVRGRRSG
QDLRGDLLNRTYTNKSSTTNSSSGVHSTSTTQTGSTERTSQSIMSGPSAGGFSATSAGSYARRGTTPAERPNTAV
DTFRSRGFSDVSRVARPETPLTGISYHSSHNTSRQGASSAIPWSSGEGGAEEPTAVFGGLSTPKAKKPGFFKKIF
ESAKTGAANARSSIAVGHNGGSSSPTKGRGISPIRALQSSRDSARDMGPGTSAIDWVQVRRDVNRASSPSRNERI
ERAERCQMMDHPVIYSVEELYETAEGDESIDGLPISEPTNFANANLNLVDKSARFVNSLPPMTNPASLAHGYVCR
PYKSDVQRLRAIFTWVSEKIAWDDPVEEIGIDLRRVLQTKRGSPQEVAFLVKEMCAAVGLHAEAINGFLKSPGEM
FDLDGLSRPNHWWNSVLVDGEWRIMDCSLASPTNPRRNQFVTNNTSVAESWYFLARPLEICYTHVPLAPEEQHIC
PPISPDVLLTLPAACPPYFKLNMQFPDFDTSIIRIDGLEVMQIRLSVPPDVECAAEVEAPAFARDADGDFFESGE
VVRKRALVQPDWVSGQKRITVKAILPGDEGQGTVKVYAGKKGLMHSSRDIPHPLALALPMLHSSENPPYDFVLRH
PTPHAQRHDLYIMQPQCAKLAVNNTFVFAVRQHPASPALSSGSNEAGVSGRVSPSVFTRPASALSMVSSSAGGST
VSGVSNEFSASTSAISSGRSMSGREKPAKLAIQSPSGKILRLTRKPEHMLSPHTGTHAFTDAPADGSVWETVIKI
GERGVWRGLVLADRVARWCVFCEWECY*
Coding >Ani_SJS72_1|g2655.t1
ATGGCCCCCGCCGCACCGCAGCTCCCGACCAGATTCCCTTGCTGGTGTCGGGCAATATACTCATGGGGCGGAGAA
ACAAAACGCGATCTGGGATTCGTGGAGGGTGACCTTATCGAGTGTCTGAATGCTGGTGATGGCCAATGGTGGATG
GGCCGATTGCGGCGTGACAGGCGCATGATGGGGTTGTTTCCCTCCAATTTCGTCGAAGTACTCAGGGAAGATTTC
GTACCAGTTCAACGATCAACGAGCCCTATGCTACCACCTGCCTCCTCGCCGATCACGAATCCAACCTCGGCTCCT
AAGAAACAAAAGACAGTCTTCCGAAAGCCATTCCAAGCCCACAAAGAAGCTCTTGCGCCTTCGGGTGAGCTATCC
CGGAGCTCGACCTCTTCATCGCCAGTGACCAGCACGATTCCGCAAACTCCACCCCGAGATGGCAGTCTTTCCTCG
CGGAAGGTGAAGCCGCTACGCACCCCAACAACCGCTGTAAAGCATCAGAGCTCTTTGTCGAGGCCCGTATCCCGG
TCTAGGCCTTTATCCCGTGCGATGTCCCCGCATCCTCCAGCCGAACCAGATCCCCAATTTTCGTCCACCCTTCCT
GGGACATACATGGCCCGGTCAAGACCTCCCTCTCGCGGAGTGTCGCCCATTCCGCCAGACCCAGAACTCCACCTT
CCTTCCATGCCATCTGTGCAAAGTGCACCACGCCCCGGACCTGCTCCTCGTGCAGTATCACCAGCTCCTCCGCCA
ACCATCGATTACCAGCTTCCATCTCTTCCCCCTATGGAAGTTGCAATCCAGAGGCCTGCGTCTCGTGCAGTGTCC
CCATACCCGCCTGATGACCAAGACCTTATGCCTCCTCAGGTTCCGAGGCACAGTATATCTCTGCACCGGCCTTCC
TCACGCGAGATATCTCCACTTCAGCTGCACGAGAGAGAAGACTCGCCGCCCCCGCCACCCCCACCACCACACAGA
GTTGCTGTCAATCGTCAGCCGTCCATCGAGCCACACGTGCCCACACGTCTGGACATGAATGATCGTTTTGTTACA
ATATCACGGACGCCATCGCCGGCTGCCCACTCCGAAGGCCGTGGACACACCCCGTCGCCCCTTCGTGATGCGATG
GAAGACGTGATGACTTCATTGGAGGATATGGGACTTCCCCGAGGCGGACAGTCGCCGTCGCCGCAGCCGATGTTC
AACAACCCGTGGTCACCGGACGCGTATGATAGCTTCCGTGAGACTCGGCCCGCGCAGACCTCCCGTCGGCCACTA
ACCTCTCTGGGATTCGATGGAGACAAGGAGTACCAATATCATGGCAGTCAGACTCACAGAAACAGCGTCTATGCA
CATGATCCCTACATGGACGGTCCGCCACAACTGAACAACTACGTACAGAGGATGGAGAGTCGACTTCGGCAGATG
CAGGAGCAGAGCCAAAGGGAGGCCGAGGAGGATGCGCAACCCTCTGATGAGGAGGAAGCCCCACCGCCTCCCCCA
AGAAACGTACCCTACCATGCCCGGCATAACTCGATCCCCGCTCAGTACCCGTTGGTGAGAGGACGAAGATCCGGC
CAAGACCTCCGTGGGGACTTGCTCAATCGGACGTATACAAATAAGTCCAGCACGACAAACTCTTCGAGTGGGGTG
CACAGTACGAGTACGACACAGACGGGCAGCACTGAGAGGACCAGTCAAAGCATCATGAGTGGTCCCTCGGCCGGT
GGATTCAGTGCAACGAGTGCGGGTAGTTATGCCAGGAGAGGTACCACTCCAGCCGAGAGACCAAACACGGCAGTC
GACACGTTTCGCTCGAGAGGCTTCAGCGATGTCTCCCGGGTGGCAAGGCCAGAAACCCCGTTAACCGGTATATCG
TACCATTCCAGCCATAATACTTCTCGGCAAGGTGCGTCGTCTGCCATACCGTGGTCGTCCGGCGAAGGCGGCGCA
GAAGAGCCGACCGCCGTGTTTGGGGGCCTTTCCACACCGAAGGCCAAGAAGCCCGGGTTCTTCAAAAAGATTTTC
GAGTCAGCGAAGACGGGTGCTGCCAACGCGAGGAGCAGCATCGCAGTCGGGCACAACGGTGGATCTTCGTCCCCC
ACCAAAGGCAGAGGAATCTCGCCAATCCGTGCTCTGCAATCCAGCCGGGACTCTGCCCGCGACATGGGGCCTGGC
ACCAGCGCCATTGATTGGGTGCAAGTCCGCCGCGATGTGAACCGCGCGAGCTCGCCCAGTCGAAACGAGAGGATC
GAGAGGGCCGAAAGATGCCAAATGATGGACCATCCTGTGATCTATTCGGTGGAGGAACTTTACGAGACGGCGGAA
GGTGATGAAAGCATTGACGGCTTGCCGATCAGTGAGCCAACCAACTTTGCCAATGCCAACTTGAATCTTGTGGAC
AAGAGCGCGCGTTTTGTCAACAGTCTTCCCCCAATGACGAATCCGGCGAGCTTAGCACATGGGTATGTCTGCCGA
CCTTACAAGAGTGATGTCCAGAGGCTGCGCGCCATCTTTACTTGGGTGAGCGAGAAGATCGCCTGGGATGACCCG
GTTGAGGAGATCGGCATTGATTTGCGGCGGGTGCTGCAGACGAAAAGAGGCAGCCCCCAGGAAGTAGCTTTCCTG
GTCAAGGAGATGTGTGCGGCGGTCGGTCTCCACGCTGAAGCGATCAATGGGTTCCTCAAAAGCCCTGGGGAGATG
TTTGACCTGGACGGCCTCTCGCGACCCAACCATTGGTGGAACTCGGTGCTTGTGGATGGCGAATGGCGCATCATG
GACTGTTCGCTTGCCAGCCCTACGAATCCCCGACGGAATCAATTTGTCACCAATAACACTTCCGTGGCCGAAAGC
TGGTATTTCCTGGCACGACCCTTGGAGATTTGCTATACGCATGTTCCTCTTGCTCCTGAGGAGCAGCACATCTGC
CCGCCTATTTCGCCGGACGTTCTACTGACGCTGCCGGCGGCCTGTCCGCCCTATTTCAAGCTGAATATGCAGTTC
CCCGATTTTGATACCAGTATCATCCGGATTGATGGCTTGGAAGTCATGCAGATCCGTCTTTCGGTGCCCCCGGAC
GTGGAATGTGCGGCCGAGGTGGAAGCCCCAGCGTTTGCCCGTGACGCCGATGGTGATTTCTTCGAAAGCGGCGAA
GTTGTGCGCAAGCGCGCGCTGGTGCAGCCCGACTGGGTCAGCGGACAGAAGCGAATTACGGTCAAAGCCATCCTG
CCCGGGGACGAAGGACAGGGCACAGTCAAGGTGTACGCCGGCAAGAAGGGATTGATGCACTCCAGTCGCGATATT
CCCCATCCGTTGGCTCTCGCCCTTCCCATGCTCCACAGCAGTGAGAACCCGCCGTACGACTTTGTGCTGCGCCAT
CCGACCCCTCACGCTCAGCGACATGATCTCTACATCATGCAGCCGCAGTGCGCGAAATTGGCGGTCAACAACACC
TTTGTTTTTGCTGTCCGCCAACATCCAGCCTCCCCGGCTTTGTCGTCCGGCAGTAATGAGGCTGGCGTCAGTGGG
CGCGTCTCACCGTCGGTCTTTACCCGGCCTGCCAGCGCATTAAGTATGGTTTCCAGTTCCGCGGGCGGTTCCACG
GTGTCCGGGGTGTCCAACGAGTTTTCTGCCTCGACGTCGGCCATTTCATCCGGCCGGTCGATGTCCGGACGTGAA
AAGCCGGCCAAGCTGGCAATTCAGTCTCCATCAGGCAAGATTCTGCGTCTGACGCGGAAGCCCGAGCATATGCTC
AGCCCCCACACAGGCACGCACGCCTTCACCGATGCGCCGGCGGACGGCAGCGTATGGGAGACGGTGATCAAGATT
GGCGAGCGCGGCGTCTGGCGAGGACTGGTACTGGCCGACCGGGTTGCACGCTGGTGTGTCTTTTGCGAATGGGAG
TGTTACTGA
Transcript >Ani_SJS72_1|g2655.t1
ATGGCCCCCGCCGCACCGCAGCTCCCGACCAGATTCCCTTGCTGGTGTCGGGCAATATACTCATGGGGCGGAGAA
ACAAAACGCGATCTGGGATTCGTGGAGGGTGACCTTATCGAGTGTCTGAATGCTGGTGATGGCCAATGGTGGATG
GGCCGATTGCGGCGTGACAGGCGCATGATGGGGTTGTTTCCCTCCAATTTCGTCGAAGTACTCAGGGAAGATTTC
GTACCAGTTCAACGATCAACGAGCCCTATGCTACCACCTGCCTCCTCGCCGATCACGAATCCAACCTCGGCTCCT
AAGAAACAAAAGACAGTCTTCCGAAAGCCATTCCAAGCCCACAAAGAAGCTCTTGCGCCTTCGGGTGAGCTATCC
CGGAGCTCGACCTCTTCATCGCCAGTGACCAGCACGATTCCGCAAACTCCACCCCGAGATGGCAGTCTTTCCTCG
CGGAAGGTGAAGCCGCTACGCACCCCAACAACCGCTGTAAAGCATCAGAGCTCTTTGTCGAGGCCCGTATCCCGG
TCTAGGCCTTTATCCCGTGCGATGTCCCCGCATCCTCCAGCCGAACCAGATCCCCAATTTTCGTCCACCCTTCCT
GGGACATACATGGCCCGGTCAAGACCTCCCTCTCGCGGAGTGTCGCCCATTCCGCCAGACCCAGAACTCCACCTT
CCTTCCATGCCATCTGTGCAAAGTGCACCACGCCCCGGACCTGCTCCTCGTGCAGTATCACCAGCTCCTCCGCCA
ACCATCGATTACCAGCTTCCATCTCTTCCCCCTATGGAAGTTGCAATCCAGAGGCCTGCGTCTCGTGCAGTGTCC
CCATACCCGCCTGATGACCAAGACCTTATGCCTCCTCAGGTTCCGAGGCACAGTATATCTCTGCACCGGCCTTCC
TCACGCGAGATATCTCCACTTCAGCTGCACGAGAGAGAAGACTCGCCGCCCCCGCCACCCCCACCACCACACAGA
GTTGCTGTCAATCGTCAGCCGTCCATCGAGCCACACGTGCCCACACGTCTGGACATGAATGATCGTTTTGTTACA
ATATCACGGACGCCATCGCCGGCTGCCCACTCCGAAGGCCGTGGACACACCCCGTCGCCCCTTCGTGATGCGATG
GAAGACGTGATGACTTCATTGGAGGATATGGGACTTCCCCGAGGCGGACAGTCGCCGTCGCCGCAGCCGATGTTC
AACAACCCGTGGTCACCGGACGCGTATGATAGCTTCCGTGAGACTCGGCCCGCGCAGACCTCCCGTCGGCCACTA
ACCTCTCTGGGATTCGATGGAGACAAGGAGTACCAATATCATGGCAGTCAGACTCACAGAAACAGCGTCTATGCA
CATGATCCCTACATGGACGGTCCGCCACAACTGAACAACTACGTACAGAGGATGGAGAGTCGACTTCGGCAGATG
CAGGAGCAGAGCCAAAGGGAGGCCGAGGAGGATGCGCAACCCTCTGATGAGGAGGAAGCCCCACCGCCTCCCCCA
AGAAACGTACCCTACCATGCCCGGCATAACTCGATCCCCGCTCAGTACCCGTTGGTGAGAGGACGAAGATCCGGC
CAAGACCTCCGTGGGGACTTGCTCAATCGGACGTATACAAATAAGTCCAGCACGACAAACTCTTCGAGTGGGGTG
CACAGTACGAGTACGACACAGACGGGCAGCACTGAGAGGACCAGTCAAAGCATCATGAGTGGTCCCTCGGCCGGT
GGATTCAGTGCAACGAGTGCGGGTAGTTATGCCAGGAGAGGTACCACTCCAGCCGAGAGACCAAACACGGCAGTC
GACACGTTTCGCTCGAGAGGCTTCAGCGATGTCTCCCGGGTGGCAAGGCCAGAAACCCCGTTAACCGGTATATCG
TACCATTCCAGCCATAATACTTCTCGGCAAGGTGCGTCGTCTGCCATACCGTGGTCGTCCGGCGAAGGCGGCGCA
GAAGAGCCGACCGCCGTGTTTGGGGGCCTTTCCACACCGAAGGCCAAGAAGCCCGGGTTCTTCAAAAAGATTTTC
GAGTCAGCGAAGACGGGTGCTGCCAACGCGAGGAGCAGCATCGCAGTCGGGCACAACGGTGGATCTTCGTCCCCC
ACCAAAGGCAGAGGAATCTCGCCAATCCGTGCTCTGCAATCCAGCCGGGACTCTGCCCGCGACATGGGGCCTGGC
ACCAGCGCCATTGATTGGGTGCAAGTCCGCCGCGATGTGAACCGCGCGAGCTCGCCCAGTCGAAACGAGAGGATC
GAGAGGGCCGAAAGATGCCAAATGATGGACCATCCTGTGATCTATTCGGTGGAGGAACTTTACGAGACGGCGGAA
GGTGATGAAAGCATTGACGGCTTGCCGATCAGTGAGCCAACCAACTTTGCCAATGCCAACTTGAATCTTGTGGAC
AAGAGCGCGCGTTTTGTCAACAGTCTTCCCCCAATGACGAATCCGGCGAGCTTAGCACATGGGTATGTCTGCCGA
CCTTACAAGAGTGATGTCCAGAGGCTGCGCGCCATCTTTACTTGGGTGAGCGAGAAGATCGCCTGGGATGACCCG
GTTGAGGAGATCGGCATTGATTTGCGGCGGGTGCTGCAGACGAAAAGAGGCAGCCCCCAGGAAGTAGCTTTCCTG
GTCAAGGAGATGTGTGCGGCGGTCGGTCTCCACGCTGAAGCGATCAATGGGTTCCTCAAAAGCCCTGGGGAGATG
TTTGACCTGGACGGCCTCTCGCGACCCAACCATTGGTGGAACTCGGTGCTTGTGGATGGCGAATGGCGCATCATG
GACTGTTCGCTTGCCAGCCCTACGAATCCCCGACGGAATCAATTTGTCACCAATAACACTTCCGTGGCCGAAAGC
TGGTATTTCCTGGCACGACCCTTGGAGATTTGCTATACGCATGTTCCTCTTGCTCCTGAGGAGCAGCACATCTGC
CCGCCTATTTCGCCGGACGTTCTACTGACGCTGCCGGCGGCCTGTCCGCCCTATTTCAAGCTGAATATGCAGTTC
CCCGATTTTGATACCAGTATCATCCGGATTGATGGCTTGGAAGTCATGCAGATCCGTCTTTCGGTGCCCCCGGAC
GTGGAATGTGCGGCCGAGGTGGAAGCCCCAGCGTTTGCCCGTGACGCCGATGGTGATTTCTTCGAAAGCGGCGAA
GTTGTGCGCAAGCGCGCGCTGGTGCAGCCCGACTGGGTCAGCGGACAGAAGCGAATTACGGTCAAAGCCATCCTG
CCCGGGGACGAAGGACAGGGCACAGTCAAGGTGTACGCCGGCAAGAAGGGATTGATGCACTCCAGTCGCGATATT
CCCCATCCGTTGGCTCTCGCCCTTCCCATGCTCCACAGCAGTGAGAACCCGCCGTACGACTTTGTGCTGCGCCAT
CCGACCCCTCACGCTCAGCGACATGATCTCTACATCATGCAGCCGCAGTGCGCGAAATTGGCGGTCAACAACACC
TTTGTTTTTGCTGTCCGCCAACATCCAGCCTCCCCGGCTTTGTCGTCCGGCAGTAATGAGGCTGGCGTCAGTGGG
CGCGTCTCACCGTCGGTCTTTACCCGGCCTGCCAGCGCATTAAGTATGGTTTCCAGTTCCGCGGGCGGTTCCACG
GTGTCCGGGGTGTCCAACGAGTTTTCTGCCTCGACGTCGGCCATTTCATCCGGCCGGTCGATGTCCGGACGTGAA
AAGCCGGCCAAGCTGGCAATTCAGTCTCCATCAGGCAAGATTCTGCGTCTGACGCGGAAGCCCGAGCATATGCTC
AGCCCCCACACAGGCACGCACGCCTTCACCGATGCGCCGGCGGACGGCAGCGTATGGGAGACGGTGATCAAGATT
GGCGAGCGCGGCGTCTGGCGAGGACTGGTACTGGCCGACCGGGTTGCACGCTGGTGTGTCTTTTGCGAATGGGAG
TGTTACTGA
Gene >Ani_SJS72_1|g2655.t1
ATGGCCCCCGCCGCACCGCAGCTCCCGACCAGATTCCCTTGCTGGTGTCGGGCAATATACTCATGGGGCGGAGAA
ACAAAACGCGATCTGGGATTCGTGGAGGGTGACCTTATCGAGTGTCTGAATGCTGGTGATGGCCAATGGTGGATG
GGCCGATTGCGGCGTGACAGGCGCATGATGGGGTTGTTTCCCTCCAATTTCGTCGAAGTACTCAGGGAAGATTTC
GTACCAGTTCAACGATCAACGAGCCCTATGCTACCACCTGCCTCCTCGCCGATCACGAATCCAACCTCGGCTCCT
AAGAAACAAAAGACAGTCTTCCGAAAGCCATTCCAAGCCCACAAAGAAGCTCTTGCGCCTTCGGGTGAGCTATCC
CGGAGCTCGACCTCTTCATCGCCAGTGACCAGCACGATTCCGCAAACTCCACCCCGAGATGGCAGTCTTTCCTCG
CGGAAGGTGAAGCCGCTACGCACCCCAACAACCGCTGTAAAGCATCAGAGCTCTTTGTCGAGGCCCGTATCCCGG
TCTAGGCCTTTATCCCGTGCGATGTCCCCGCATCCTCCAGCCGAACCAGATCCCCAATTTTCGTCCACCCTTCCT
GGGACATACATGGCCCGGTCAAGACCTCCCTCTCGCGGAGTGTCGCCCATTCCGCCAGACCCAGAACTCCACCTT
CCTTCCATGCCATCTGTGCAAAGTGCACCACGCCCCGGACCTGCTCCTCGTGCAGTATCACCAGCTCCTCCGCCA
ACCATCGATTACCAGCTTCCATCTCTTCCCCCTATGGAAGTTGCAATCCAGAGGCCTGCGTCTCGTGCAGTGTCC
CCATACCCGCCTGATGACCAAGACCTTATGCCTCCTCAGGTTCCGAGGCACAGTATATCTCTGCACCGGCCTTCC
TCACGCGAGATATCTCCACTTCAGCTGCACGAGAGAGAAGACTCGCCGCCCCCGCCACCCCCACCACCACACAGA
GTTGCTGTCAATCGTCAGCCGTCCATCGAGCCACACGTGCCCACACGTCTGGACATGAATGATCGTTTTGTTACA
ATATCACGGACGCCATCGCCGGCTGCCCACTCCGAAGGCCGTGGACACACCCCGTCGCCCCTTCGTGATGCGATG
GAAGACGTGATGACTTCATTGGAGGATATGGGACTTCCCCGAGGCGGACAGTCGCCGTCGCCGCAGCCGATGTTC
AACAACCCGTGGTCACCGGACGCGTATGATAGCTTCCGTGAGACTCGGCCCGCGCAGACCTCCCGTCGGCCACTA
ACCTCTCTGGGATTCGATGGAGACAAGGAGTACCAATATCATGGCAGTCAGACTCACAGAAACAGCGTCTATGCA
CATGATCCCTACATGGACGGTCCGCCACAACTGAACAACTACGTACAGAGGATGGAGAGTCGACTTCGGCAGATG
CAGGAGCAGAGCCAAAGGGAGGCCGAGGAGGATGCGCAACCCTCTGATGAGGAGGAAGCCCCACCGCCTCCCCCA
AGAAACGTACCCTACCATGCCCGGCATAACTCGATCCCCGCTCAGTACCCGTTGGTGAGAGGACGAAGATCCGGC
CAAGACCTCCGTGGGGACTTGCTCAATCGGACGTATACAAATAAGTCCAGCACGACAAACTCTTCGAGTGGGGTG
CACAGTACGAGTACGACACAGACGGGCAGCACTGAGAGGACCAGTCAAAGCATCATGAGTGGTCCCTCGGCCGGT
GGATTCAGTGCAACGAGTGCGGGTAGTTATGCCAGGAGAGGTACCACTCCAGCCGAGAGACCAAACACGGCAGTC
GACACGTTTCGCTCGAGAGGCTTCAGCGATGTCTCCCGGGTGGCAAGGCCAGAAACCCCGTTAACCGGTATATCG
TACCATTCCAGCCATAATACTTCTCGGCAAGGTGCGTCGTCTGCCATACCGTGGTCGTCCGGCGAAGGCGGCGCA
GAAGAGCCGACCGCCGTGTTTGGGGGCCTTTCCACACCGAAGGCCAAGAAGCCCGGGTTCTTCAAAAAGATTTTC
GAGTCAGCGAAGACGGGTGCTGCCAACGCGAGGAGCAGCATCGCAGTCGGGCACAACGGTGGATCTTCGTCCCCC
ACCAAAGGCAGAGGAATCTCGCCAATCCGTGCTCTGCAATCCAGCCGGGACTCTGCCCGCGACATGGGGCCTGGC
ACCAGCGCCATTGATTGGGTGCAAGTCCGCCGCGATGTGAACCGCGCGAGCTCGCCCAGTCGAAACGAGAGGATC
GAGAGGGCCGAAAGATGCCAAATGATGGACCATCCTGTGATCTATTCGGTGGAGGAACTTTACGAGACGGCGGAA
GGTGATGAAAGCATTGACGGCTTGCCGATCAGTGAGCCAACCAACTTTGCCAATGCCAACTTGAATCTTGTGGAC
AAGAGCGCGCGTTTTGTCAACAGTCTTCCCCCAATGACGAATCCGGCGAGCTTAGCACATGGGTATGTCTGCCGA
CCTTACAAGAGTGATGTCCAGAGGCTGCGCGCCATCTTTACTTGGGTGAGCGAGAAGATCGCCTGGGATGACCCG
GTTGAGGAGATCGGCATTGATTTGCGGCGGGTGCTGCAGACGAAAAGAGGCAGCCCCCAGGAAGTAGCTTTCCTG
GTCAAGGAGATGTGTGCGGCGGTCGGTCTCCACGCTGAAGCGATCAATGGGTTCCTCAAAAGCCCTGGGGAGATG
TTTGACCTGGACGGCCTCTCGCGACCCAACCATTGGTGGAACTCGGTGCTTGTGGATGGCGAATGGCGCATCATG
GACTGTTCGCTTGCCAGCCCTACGAATCCCCGACGGAATCAATTTGTCACCAATAACACTTCCGTGGCCGAAAGC
TGGTATTTCCTGGCACGACCCTTGGAGATTTGCTATACGCATGTTCCTCTTGCTCCTGAGGAGCAGCACATCTGC
CCGCCTATTTCGCCGGACGTTCTACTGACGCTGCCGGCGGCCTGTCCGCCCTATTTCAAGCTGAATATGCAGTTC
CCCGATTTTGATACCAGTATCATCCGGATTGATGGCTTGGAAGTCATGCAGATCCGTCTTTCGGTGCCCCCGGAC
GTGGAATGTGCGGCCGAGGTGGAAGCCCCAGCGTTTGCCCGTGACGCCGATGGTGATTTCTTCGAAAGCGGCGAA
GTTGTGCGCAAGCGCGCGCTGGTGCAGCCCGACTGGGTCAGCGGACAGAAGCGAATTACGGTCAAAGCCATCCTG
CCCGGGGACGAAGGACAGGGCACAGTCAAGGTGTACGCCGGCAAGAAGGGATTGATGCACTCCAGTCGCGATATT
CCCCATCCGTTGGCTCTCGCCCTTCCCATGCTCCACAGCAGTGAGAACCCGCCGTACGACTTTGTGCTGCGCCAT
CCGACCCCTCACGCTCAGCGACATGATCTCTACATCATGCAGCCGCAGTGCGCGAAATTGGCGGTCAACAACACC
TTTGTTTTTGCTGTCCGCCAACATCCAGCCTCCCCGGCTTTGTCGTCCGGCAGTAATGAGGCTGGCGTCAGTGGG
CGCGTCTCACCGTCGGTCTTTACCCGGCCTGCCAGCGCATTAAGTATGGTTTCCAGTTCCGCGGGCGGTTCCACG
GTGTCCGGGGTGTCCAACGAGTTTTCTGCCTCGACGTCGGCCATTTCATCCGGCCGGTCGATGTCCGGACGTGAA
AAGCCGGCCAAGCTGGCAATTCAGTCTCCATCAGGCAAGATTCTGCGTCTGACGCGGAAGCCCGAGCATATGCTC
AGCCCCCACACAGGCACGCACGCCTTCACCGATGCGCCGGCGGACGGCAGCGTATGGGAGACGGTGATCAAGATT
GGCGAGCGCGGCGTCTGGCGAGGACTGGTACTGGCCGACCGGGTTGCACGCTGGTGTGTCTTTTGCGAATGGGAG
TGTTACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail