Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g2618.t1
Gene name
Locationscaffold_013:360081..361966
Strand-
Gene length (bp)1885
Transcript length (bp)1437
Coding sequence length (bp)1437
Protein length (aa) 479

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6 4.5E-107 131 444
PF00734 CBM_1 Fungal cellulose binding domain 2.2E-12 22 50

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0005576 extracellular region Yes
GO:0030245 cellulose catabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0030248 cellulose binding Yes
GO:0005488 binding No
GO:0030246 carbohydrate binding No
GO:0009987 cellular process No
GO:0016052 carbohydrate catabolic process No
GO:0044275 cellular carbohydrate catabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0006073 cellular glucan metabolic process No
GO:0003674 molecular_function No
GO:0051275 beta-glucan catabolic process No
GO:0044264 cellular polysaccharide metabolic process No
GO:0030243 cellulose metabolic process No
GO:0009251 glucan catabolic process No
GO:0044248 cellular catabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0000272 polysaccharide catabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0030247 polysaccharide binding No
GO:0005575 cellular_component No
GO:0044237 cellular metabolic process No
GO:0044042 glucan metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:0016787 hydrolase activity No
GO:0044247 cellular polysaccharide catabolic process No
GO:0005976 polysaccharide metabolic process No
GO:0110165 cellular anatomical entity No
GO:0003824 catalytic activity No
GO:0044262 cellular carbohydrate metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0051273 beta-glucan metabolic process No
GO:1901575 organic substance catabolic process No
GO:0071704 organic substance metabolic process No
GO:0009056 catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g2618.t1
MHYPLSLALAFLPFGIQAQQTLWGQCGGQGYSGATSCVAGATCATVNEYYAQCTPAAGTSSATTLKTTTSSTTAA
VTTTTTTQSPTGSASPTTTASASGNPFSGYQLYVNPYYSSEVASLAIPSLTGSLSSLQAAATAAAKVPSFVWLYA
PSFYNVIYNSLLLTFARDTAAKVPTMGDYLADIQSQNAAGANPPIAGQFVVYDLPDRDCAALASNGEYSIADNGV
EHYKSYIDSIREILVQYSDVHTLLVIEPDSLANLVTNLNVAKCANAESAYLECTNYALTQLNLPNVAMYLDAGHA
GWLGWPANQQPAADLFASVYKNASSPAAVRGLATNVANYNAWTISSCPSYTQGNSVCDEQQYINAIAPLLQAQGF
DAHFIVDTGRNGKQPTGQQAWGDWCNVINTGFGERPTTDTGDALVDAFVWVKPGGESDGTSDSSATRYDAHCGYS
DALQPAPEAGTWFQAYFVQLLTNANPAF*
Coding >Ani_SJS72_1|g2618.t1
ATGCACTATCCATTGTCTCTCGCATTGGCATTTCTGCCATTCGGAATCCAGGCTCAGCAAACCCTTTGGGGACAA
TGTGGTGGTCAGGGATATTCAGGAGCCACCAGTTGTGTGGCTGGCGCAACATGCGCAACTGTGAATGAATACTAT
GCTCAGTGTACGCCAGCGGCAGGCACGAGCTCAGCCACTACCTTGAAGACAACTACGAGTAGTACCACCGCTGCA
GTGACGACGACTACCACTACTCAAAGCCCTACCGGCTCTGCTTCGCCGACTACCACTGCCAGCGCTAGCGGCAAC
CCGTTCAGTGGGTACCAGCTCTACGTGAACCCATACTACTCATCGGAAGTCGCGTCTCTGGCCATTCCATCTCTC
ACTGGTTCTCTCTCCTCGCTCCAGGCGGCGGCAACCGCCGCAGCCAAGGTGCCTTCTTTTGTGTGGCTGTATGCT
CCCTCATTCTACAATGTAATCTATAATAGCCTCTTGTTGACATTTGCCAGGGATACTGCCGCTAAAGTTCCTACC
ATGGGCGACTATCTGGCCGACATCCAATCCCAGAATGCTGCTGGAGCGAACCCCCCAATCGCCGGTCAATTTGTG
GTATACGACCTCCCCGACCGCGACTGCGCCGCGCTCGCCAGCAACGGCGAGTATTCGATCGCGGACAATGGGGTT
GAACACTACAAGTCCTACATTGATTCCATCCGCGAGATTCTTGTGCAGTATTCAGATGTTCATACCCTCCTGGTG
ATTGAGCCTGACAGTCTCGCCAACCTGGTGACAAACCTCAATGTGGCCAAATGTGCCAATGCTGAAAGTGCATAC
CTTGAATGTACGAATTATGCGTTGACTCAGCTCAATCTTCCCAACGTGGCCATGTATCTTGACGCCGGACACGCC
GGCTGGCTTGGCTGGCCCGCAAATCAGCAACCCGCCGCCGACCTGTTTGCGAGCGTCTACAAAAATGCCAGTTCC
CCCGCTGCGGTGCGCGGCCTGGCCACCAACGTTGCTAACTACAACGCCTGGACCATTTCTTCCTGTCCCTCCTAC
ACCCAGGGAAACAGCGTCTGCGACGAGCAACAGTACATCAATGCCATTGCCCCGCTGCTACAGGCACAGGGCTTC
GACGCCCACTTCATCGTCGATACCGGCCGCAACGGCAAACAGCCCACGGGCCAACAGGCCTGGGGTGACTGGTGC
AATGTCATTAACACAGGCTTTGGCGAGCGCCCGACCACCGACACCGGCGATGCGCTCGTCGACGCCTTCGTCTGG
GTGAAGCCGGGGGGCGAGAGCGATGGCACCTCCGATAGCTCGGCCACTCGATACGATGCCCACTGTGGGTATAGC
GATGCCTTGCAGCCGGCGCCTGAGGCGGGAACTTGGTTCCAGGCCTACTTCGTGCAGCTGCTCACCAACGCCAAT
CCAGCTTTCTAG
Transcript >Ani_SJS72_1|g2618.t1
ATGCACTATCCATTGTCTCTCGCATTGGCATTTCTGCCATTCGGAATCCAGGCTCAGCAAACCCTTTGGGGACAA
TGTGGTGGTCAGGGATATTCAGGAGCCACCAGTTGTGTGGCTGGCGCAACATGCGCAACTGTGAATGAATACTAT
GCTCAGTGTACGCCAGCGGCAGGCACGAGCTCAGCCACTACCTTGAAGACAACTACGAGTAGTACCACCGCTGCA
GTGACGACGACTACCACTACTCAAAGCCCTACCGGCTCTGCTTCGCCGACTACCACTGCCAGCGCTAGCGGCAAC
CCGTTCAGTGGGTACCAGCTCTACGTGAACCCATACTACTCATCGGAAGTCGCGTCTCTGGCCATTCCATCTCTC
ACTGGTTCTCTCTCCTCGCTCCAGGCGGCGGCAACCGCCGCAGCCAAGGTGCCTTCTTTTGTGTGGCTGTATGCT
CCCTCATTCTACAATGTAATCTATAATAGCCTCTTGTTGACATTTGCCAGGGATACTGCCGCTAAAGTTCCTACC
ATGGGCGACTATCTGGCCGACATCCAATCCCAGAATGCTGCTGGAGCGAACCCCCCAATCGCCGGTCAATTTGTG
GTATACGACCTCCCCGACCGCGACTGCGCCGCGCTCGCCAGCAACGGCGAGTATTCGATCGCGGACAATGGGGTT
GAACACTACAAGTCCTACATTGATTCCATCCGCGAGATTCTTGTGCAGTATTCAGATGTTCATACCCTCCTGGTG
ATTGAGCCTGACAGTCTCGCCAACCTGGTGACAAACCTCAATGTGGCCAAATGTGCCAATGCTGAAAGTGCATAC
CTTGAATGTACGAATTATGCGTTGACTCAGCTCAATCTTCCCAACGTGGCCATGTATCTTGACGCCGGACACGCC
GGCTGGCTTGGCTGGCCCGCAAATCAGCAACCCGCCGCCGACCTGTTTGCGAGCGTCTACAAAAATGCCAGTTCC
CCCGCTGCGGTGCGCGGCCTGGCCACCAACGTTGCTAACTACAACGCCTGGACCATTTCTTCCTGTCCCTCCTAC
ACCCAGGGAAACAGCGTCTGCGACGAGCAACAGTACATCAATGCCATTGCCCCGCTGCTACAGGCACAGGGCTTC
GACGCCCACTTCATCGTCGATACCGGCCGCAACGGCAAACAGCCCACGGGCCAACAGGCCTGGGGTGACTGGTGC
AATGTCATTAACACAGGCTTTGGCGAGCGCCCGACCACCGACACCGGCGATGCGCTCGTCGACGCCTTCGTCTGG
GTGAAGCCGGGGGGCGAGAGCGATGGCACCTCCGATAGCTCGGCCACTCGATACGATGCCCACTGTGGGTATAGC
GATGCCTTGCAGCCGGCGCCTGAGGCGGGAACTTGGTTCCAGGCCTACTTCGTGCAGCTGCTCACCAACGCCAAT
CCAGCTTTCTAG
Gene >Ani_SJS72_1|g2618.t1
ATGCACTATCCATTGTCTCTCGCATTGGCATTTCTGCCATTCGGAATCCAGGCTCAGCAAACCCTTTGGGGACAA
TGTGGTGGTCAGGGATATTCAGGAGCCACCAGTTGTGTGGCTGGCGCAACATGCGCAACTGTGAATGAATGTAAG
GGTTCCTTCTGGGGATTTTGCTGATCGATAGCTGAGTGACCATGGCCATTAGACTATGCTCAGTGTACGCCAGCG
GCAGGCACGAGCTCAGCCACTACCTTGAAGACAACTACGAGTAGTACCACCGCTGCAGTGACGACGACTACCACT
ACTCAAAGCCCTACCGGCTCTGCTTCGCCGACTACCACTGCCAGCGCTAGCGGCAACCCGTTCAGTGGGTACCAG
CTCTACGTGAACCCATACTACTCATCGGAAGTCGCGTCTCTGGCCATTCCATCTCTCACTGGTTCTCTCTCCTCG
CTCCAGGCGGCGGCAACCGCCGCAGCCAAGGTGCCTTCTTTTGTGTGGCTGTATGCTCCCTCATTCTACAATGTA
ATCTATAATAGCCTCTTGTTGACATTTGCCAGGGATACTGCCGCTAAAGTTCCTACCATGGGCGACTATCTGGCC
GACATCCAATCCCAGAATGCTGCTGGAGCGAACCCCCCAATCGCCGGTCAATTTGTGGTATACGACCTCCCCGAC
CGCGACTGCGCCGCGCTCGCCAGCAACGGCGAGTATTCGATCGCGGACAATGGGGTTGAACACTACAAGTCCTAC
ATTGATTCCATCCGCGAGATTCTTGTGCAGTATTCAGATGTTCATACCCTCCTGGTGATTGGTGAGTGTCTTCCC
ACTGGGTTCGGACATGGCCTACTGTATCTGAACGCTAAATGTCACCTCCCCCAACAGAGCCTGACAGTCTCGCCA
ACCTGGTGACAAACCTCAATGTGGCCAAATGTGCCAATGCTGAAAGTGCATACCTTGAATGTACGAATTATGCGT
TGACTCAGCTCAATCTTCCCAACGTGGCCATGTATCTTGACGCCGGTAAGCTGCCTATCCATCATATCTACTTAC
TCTTCAAGTATCCACGGGGAGGGACCGCCGAGACACCCTTTGCATTCAGCTTCCCTGGCAAATTTCCCCTTTACA
TACCCAGCCCAGTCGAAGATCCCTCCCCCCTCCGATTAAACCCTCTTGACAGAACCTGACCAAAGAACTTTAGGA
CACGCCGGCTGGCTTGGCTGGCCCGCAAATCAGCAACCCGCCGCCGACCTGTTTGCGAGCGTCTACAAAAATGCC
AGTTCCCCCGCTGCGGTGCGCGGCCTGGCCACCAACGTTGCTAACTACAACGCCTGGACCATTTCTTCCTGTCCC
TCCTACACCCAGGGAAACAGCGTCTGCGACGAGCAACAGTACATCAATGCCATTGCCCCGCTGCTACAGGCACAG
GGCTTCGACGCCCACTTCATCGTCGATACCGGTATGCGCAATTCCGCAACCCCCAGTAACCCTTCGCCCTGCCCC
TGGCTAACATGTATCACTAAATTCCAGGCCGCAACGGCAAACAGCCCACGGGCCAACAGGCCTGGGGTGACTGGT
GCAATGTCATTAACACAGGCTTTGGCGAGCGCCCGACCACCGACACCGGCGATGCGCTCGTCGACGCCTTCGTCT
GGGTGAAGCCGGGGGGCGAGAGCGATGGCACCTCCGATAGCTCGGCCACTCGATACGATGCCCACTGTGGGTATA
GCGATGCCTTGCAGCCGGCGCCTGAGGCGGGAACTTGGTTCCAGGTATGTTTACCGATCAAGCTCGTTGGCTAAG
AATGAATTGGATGATGGGACTGACGTGATTGTGCTCGTAGGCCTACTTCGTGCAGCTGCTCACCAACGCCAATCC
AGCTTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail