Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g2479.t1
Gene name
Locationscaffold_012:387312..389271
Strand+
Gene length (bp)1959
Transcript length (bp)1419
Coding sequence length (bp)1419
Protein length (aa) 473

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00190 Cupin_1 Cupin 4.8E-18 156 264
PF00190 Cupin_1 Cupin 4.9E-20 314 441
PF07883 Cupin_2 Cupin domain 1.8E-08 162 224
PF07883 Cupin_2 Cupin domain 4.2E-13 342 415
PF02311 AraC_binding AraC-like ligand binding domain 2.1E-04 171 224

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0031323 regulation of cellular metabolic process No
GO:0050794 regulation of cellular process No
GO:0008150 biological_process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0019222 regulation of metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0010468 regulation of gene expression No
GO:0031326 regulation of cellular biosynthetic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0065007 biological regulation No
GO:0050789 regulation of biological process No
GO:0009889 regulation of biosynthetic process No
GO:1903506 regulation of nucleic acid-templated transcription No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g2479.t1
MKPSTLYSSLPWVITSLFTVAVHGAPTGTKSNPPLRGSENLLGYSASNTVTDQSTDDIPYVPVPGQTDSADLGVY
LDFDDVENPQPVRGSTGGTDPGPRNDYYDRMNSDKLAPPGTDNGQTINAQWPMGLSHNRLGLNESGWARQENEVV
MPGATDMAGVDMRLEAGAYRELHWHVASEWSLVLNGSCRIEAVNENGQTFVDDVSAGDVWFFPPGVPHSIQALDS
GVEFLLIFDDGSFSEDNTFLATEVFAHQPREVLSKNFDLPVAAFDDIPEDELYIFPGTPAPQNISEQNVTGSAGV
LPQSQSYSYHFSEQPAHEVQGGSVKIVDSLTFPISSNTAAALVTVHPGGMREIHWHPSSDEWTFFISGKARATLF
TAPSTATTFDYRPGDVGYFPQSNSHYIENTGDEDLVFLEVLQTDEFTDISLGQWIGSTPKQIVADTLHLPQSALD
RLKTEKMYVVAGSNETDVATTD*
Coding >Ani_SJS72_1|g2479.t1
ATGAAACCATCTACTCTCTACTCTTCTCTACCCTGGGTCATCACGTCCCTCTTCACGGTAGCTGTTCATGGCGCT
CCTACAGGGACAAAGTCGAATCCTCCCCTACGAGGCTCCGAGAATCTGCTGGGCTACTCGGCCTCCAACACCGTG
ACGGACCAGTCCACCGATGATATCCCCTATGTCCCGGTGCCAGGACAGACGGATTCCGCTGACCTCGGCGTATAC
CTGGACTTTGACGATGTTGAGAACCCGCAACCGGTCCGTGGAAGCACGGGAGGAACTGACCCTGGACCTCGCAAC
GACTACTACGATCGGATGAACAGCGATAAGCTGGCCCCTCCGGGAACGGACAATGGCCAGACGATCAATGCCCAA
TGGCCTATGGGACTAAGCCATAATCGGCTGGGATTGAATGAGTCTGGATGGGCTCGGCAAGAGAACGAGGTGGTG
ATGCCGGGCGCGACCGACATGGCTGGAGTGGATATGCGCCTAGAAGCAGGTGCCTATCGGGAGCTGCATTGGCAT
GTGGCATCGGAATGGTCTCTGGTGTTGAACGGATCGTGTCGGATCGAGGCCGTTAATGAAAACGGACAAACTTTC
GTCGATGACGTGAGTGCCGGCGATGTCTGGTTCTTCCCTCCCGGTGTTCCGCATTCCATCCAAGCCCTCGACTCG
GGCGTCGAGTTTCTCCTCATCTTCGACGACGGTTCCTTTTCCGAGGATAATACCTTCCTCGCCACTGAAGTGTTT
GCCCATCAACCGCGCGAAGTTCTCTCTAAAAATTTCGACCTCCCCGTCGCCGCTTTCGACGACATCCCCGAAGAT
GAACTCTATATCTTCCCTGGCACTCCGGCACCGCAAAACATCTCCGAGCAGAATGTAACTGGCTCTGCAGGCGTC
CTGCCGCAGTCTCAAAGCTACTCGTATCACTTTTCCGAGCAGCCCGCACACGAAGTGCAAGGCGGATCCGTCAAG
ATCGTCGACTCCCTCACCTTCCCGATCTCCTCCAACACGGCCGCCGCGCTGGTGACAGTGCACCCAGGTGGCATG
CGTGAAATTCACTGGCACCCGAGCAGCGATGAATGGACCTTCTTCATCAGCGGCAAGGCACGCGCGACCCTGTTC
ACGGCGCCCAGCACGGCTACGACGTTCGATTACCGCCCGGGTGATGTAGGATACTTCCCGCAGAGCAACAGCCAT
TATATCGAGAACACAGGAGATGAGGATTTGGTGTTTTTGGAAGTGCTGCAGACGGATGAATTCACCGATATCTCA
TTGGGCCAGTGGATCGGATCCACGCCGAAGCAGATTGTCGCGGATACGCTGCACCTGCCGCAGAGTGCGCTGGAT
CGGCTGAAGACGGAGAAGATGTATGTGGTGGCTGGATCGAATGAGACGGATGTTGCTACTACTGATTAG
Transcript >Ani_SJS72_1|g2479.t1
ATGAAACCATCTACTCTCTACTCTTCTCTACCCTGGGTCATCACGTCCCTCTTCACGGTAGCTGTTCATGGCGCT
CCTACAGGGACAAAGTCGAATCCTCCCCTACGAGGCTCCGAGAATCTGCTGGGCTACTCGGCCTCCAACACCGTG
ACGGACCAGTCCACCGATGATATCCCCTATGTCCCGGTGCCAGGACAGACGGATTCCGCTGACCTCGGCGTATAC
CTGGACTTTGACGATGTTGAGAACCCGCAACCGGTCCGTGGAAGCACGGGAGGAACTGACCCTGGACCTCGCAAC
GACTACTACGATCGGATGAACAGCGATAAGCTGGCCCCTCCGGGAACGGACAATGGCCAGACGATCAATGCCCAA
TGGCCTATGGGACTAAGCCATAATCGGCTGGGATTGAATGAGTCTGGATGGGCTCGGCAAGAGAACGAGGTGGTG
ATGCCGGGCGCGACCGACATGGCTGGAGTGGATATGCGCCTAGAAGCAGGTGCCTATCGGGAGCTGCATTGGCAT
GTGGCATCGGAATGGTCTCTGGTGTTGAACGGATCGTGTCGGATCGAGGCCGTTAATGAAAACGGACAAACTTTC
GTCGATGACGTGAGTGCCGGCGATGTCTGGTTCTTCCCTCCCGGTGTTCCGCATTCCATCCAAGCCCTCGACTCG
GGCGTCGAGTTTCTCCTCATCTTCGACGACGGTTCCTTTTCCGAGGATAATACCTTCCTCGCCACTGAAGTGTTT
GCCCATCAACCGCGCGAAGTTCTCTCTAAAAATTTCGACCTCCCCGTCGCCGCTTTCGACGACATCCCCGAAGAT
GAACTCTATATCTTCCCTGGCACTCCGGCACCGCAAAACATCTCCGAGCAGAATGTAACTGGCTCTGCAGGCGTC
CTGCCGCAGTCTCAAAGCTACTCGTATCACTTTTCCGAGCAGCCCGCACACGAAGTGCAAGGCGGATCCGTCAAG
ATCGTCGACTCCCTCACCTTCCCGATCTCCTCCAACACGGCCGCCGCGCTGGTGACAGTGCACCCAGGTGGCATG
CGTGAAATTCACTGGCACCCGAGCAGCGATGAATGGACCTTCTTCATCAGCGGCAAGGCACGCGCGACCCTGTTC
ACGGCGCCCAGCACGGCTACGACGTTCGATTACCGCCCGGGTGATGTAGGATACTTCCCGCAGAGCAACAGCCAT
TATATCGAGAACACAGGAGATGAGGATTTGGTGTTTTTGGAAGTGCTGCAGACGGATGAATTCACCGATATCTCA
TTGGGCCAGTGGATCGGATCCACGCCGAAGCAGATTGTCGCGGATACGCTGCACCTGCCGCAGAGTGCGCTGGAT
CGGCTGAAGACGGAGAAGATGTATGTGGTGGCTGGATCGAATGAGACGGATGTTGCTACTACTGATTAG
Gene >Ani_SJS72_1|g2479.t1
ATGAAACCATCTACTCTCTACTCTTCTCTACCCTGGGTCATCACGTCCCTCTTCACGGTAGCTGTTCATGGCGCT
CCTACAGGGACAAAGTCGAATCCTCCCCTACGAGGCTCCGAGAATCTGCTGGGCTACTCGGCCTCCAACACCGTG
ACGGACCAGTCCACCGATGATATCCCCTATGTCCCGGTGCCAGGACAGACGGATTCCGCTGACCTCGGCGTATAC
CTGGACTTTGACGATGTTGAGAACCCGCAACCGGTCCGTGGAAGCACGGGAGGAACTGACCCTGGACCTCGTATG
TAGCGTCGATCCATGGAACCAGACCAGGCGTTTGGTTGATCTGCGAATGATCTCATCTCACACCGGAAAATAGGC
AACGACTACTACGATCGGATGAACAGCGATAAGCTGGCCCCTCCGGGAACGGACAATGGCCAGACGATCAATGCC
CAATGGCCTATGGGTGAGTCCAATTTGCCTTGCCTTTTTTTTTTTTTTTCTTTTCTTTTTCTATAATCGTTTAGC
CCCTTTATTTGCTTTTTCGGCGGAAAAAGTTTAATGAGACAGAACAATGGCTAACAATCGGGTATAGGACTAAGC
CATAATCGGTAAGCCGACCTGCCCTTGCTGCAATGCATGATGTACTATATACTAACTGGAGTGAAGGCTGGGATT
GAATGAGTCTGGATGGGCTCGGCAAGAGAACGAGGTGGTGATGCCGGGCGCGACCGACATGGCTGGAGTGGATAT
GCGCCTAGAAGCAGGTGCCTATCGGGAGCTGCATTGGCATGTGGCATCGGAATGGTCTCTGGTGTTGAACGGATC
GTGTCGGATCGAGGTAAGATGCAGATAGAGAGAAAGTCTGATAAACCAGTTTGTGAAAGCTAATTCTTATCAACC
AGGCCGTTAATGAAAACGGACAAACTTTCGTCGATGACGTGAGTGCCGGCGATGTCTGGTTCTTCCCTCCGTAAG
TTTTTCGCTCCAATTCCAAATCATTGTCCCTTTCATAGGGATGCATCGATGGGATGGTTGGCTGACTTACTCCTT
ACAGCGGTGTTCCGCATTCCATCCAAGCCCTCGACTCGGGCGTCGAGTTTCTCCTCATCTTCGACGACGGTTCCT
TTTCCGAGGATAATACCTTCCTCGCCACTGAAGTGTTTGCCCATCAACCGGTACCCCTCACTTGCTCCACCCAAA
GTATGTGTGATGATTGACTAACGATGGCTATAGCGCGAAGTTCTCTCTAAAAATTTCGACCTCCCCGTCGCCGCT
TTCGACGACATCCCCGAAGATGAACTCTATATCTTCCCTGGCACTCCGGCACCGCAAAACATCTCCGAGCAGAAT
GTAACTGGCTCTGCAGGCGTCCTGCCGCAGTCTCAAAGCTACTCGTATCACTTTTCCGAGCAGCCCGCACACGAA
GTGCAAGGCGGATCCGTCAAGATCGTCGACTCCCTCACCTTCCCGATCTCCTCCAACACGGCCGCCGCGCTGGTG
ACAGTGCACCCAGGTGGCATGCGTGAAATTCACTGGCACCCGAGCAGCGATGAATGGACCTTCTTCATCAGCGGC
AAGGCACGCGCGACCCTGTTCACGGCGCCCAGCACGGCTACGACGTTCGATTACCGCCCGGGTGATGTAGGATAC
TTCCCGCAGAGCAACAGCCATTATATCGAGAACACAGGAGATGAGGATTTGGTGTTTTTGGAAGTGCTGCAGACG
GATGAATTCACCGGTAAGCCATCATTTCACTTTTCTTCTGTTTTAAAGAGTTGTAAATGTCAGTACTAATTGTGG
TATGCAGATATCTCATTGGGCCAGTGGATCGGATCCACGCCGAAGCAGATTGTCGCGGATACGCTGCACCTGCCG
CAGAGTGCGCTGGATCGGCTGAAGACGGAGAAGATGTATGTGGTGGCTGGATCGAATGAGACGGATGTTGCTACT
ACTGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail