Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g2363.t1
Gene name
Locationscaffold_012:32528..34520
Strand-
Gene length (bp)1992
Transcript length (bp)1494
Coding sequence length (bp)1494
Protein length (aa) 498

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00135 COesterase Carboxylesterase family 1.2E-59 20 292
PF00135 COesterase Carboxylesterase family 3.1E-09 341 467
PF20434 BD-FAE BD-FAE 5.0E-09 88 199
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 3.3E-07 102 199

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g2363.t1
MLPTLSWLALGMASLATCTDPVAQTKNGSYYGVYMPQYNEDYFLGIPFAKPPLAHLRWANPGSLNESWSGLRPAT
GYAMSEDCLYLNVVRPAGYDNASLPVLVWIHGGGFAQGSTPDLRYNLTFIVKHSLNIDQPIIAVSVAYRLGPWGF
FNGVELANEGSLNLGLKDQRLALHWVKENIAGFGGDPSKVVIYGQSAGSESVGYQIRAYNGRDDGLFRGGMMESG
AVLPGSGLNLTWTYEPWFQQIADEAGCSQAIRKLDCLRRTPFTVLNNILNTTANNTTPYNWRPTVDATTTYGWAL
DSQVVSSLLDLYPNTTSFGIPSSEELGGNVTFPQPYGAAFRQTAAYYGDAQFIAATRYTCELWAAHNLTAYCYRF
NTKTDDYNWEEGVAHFSDVIFIFNNLNGYGFSPNPFTNAPESYTELSYLMSGSWISFTNSLDPNKWTGRGRNATK
TENWPVYDLENPLSMIWDANVTSYAAPDTWRKEGIALINANRRAYQR*
Coding >Ani_SJS72_1|g2363.t1
ATGCTCCCGACGCTTAGTTGGTTGGCCCTGGGCATGGCCAGTCTGGCAACCTGCACCGACCCAGTGGCCCAGACA
AAGAACGGAAGTTATTATGGTGTCTACATGCCTCAGTATAATGAGGATTATTTTCTTGGAATTCCATTTGCTAAG
CCCCCGTTGGCACACTTGCGTTGGGCCAACCCCGGGAGTCTTAATGAGTCTTGGTCGGGATTGCGCCCTGCTACC
GGCTATGCGATGAGCGAGGATTGTCTCTACCTAAACGTGGTCCGTCCCGCTGGATACGACAATGCCAGTCTTCCA
GTCCTTGTATGGATTCATGGTGGTGGCTTCGCACAAGGCAGCACTCCCGACCTCCGATACAATCTTACATTCATT
GTTAAGCACTCGCTCAATATCGACCAGCCAATTATCGCAGTGAGCGTTGCCTATCGTCTCGGTCCTTGGGGTTTC
TTCAATGGGGTCGAGCTCGCCAATGAGGGATCGTTAAATCTCGGGCTGAAGGACCAGCGCTTGGCTTTGCATTGG
GTGAAAGAGAACATTGCAGGTTTCGGTGGCGACCCTAGTAAAGTCGTGATTTACGGACAGAGTGCCGGCTCCGAA
AGCGTGGGATACCAAATCCGCGCGTACAACGGCCGAGATGACGGGCTTTTCCGCGGAGGCATGATGGAGTCCGGC
GCGGTGCTACCTGGCAGTGGCTTGAACCTCACCTGGACGTATGAGCCCTGGTTCCAGCAAATAGCAGACGAGGCA
GGATGTTCCCAGGCCATCCGCAAACTGGACTGTCTACGCCGCACGCCCTTCACAGTCCTCAACAACATCCTGAAC
ACGACCGCCAACAACACAACGCCTTACAACTGGAGGCCCACAGTGGACGCAACAACAACCTACGGCTGGGCCCTC
GACTCACAGGTAGTATCCTCGCTCTTGGACCTCTACCCCAACACCACCTCCTTCGGCATCCCATCATCCGAAGAA
CTCGGCGGCAACGTCACCTTCCCACAGCCCTACGGCGCCGCATTCCGCCAGACGGCCGCATACTACGGCGACGCC
CAGTTCATAGCCGCGACGCGCTACACCTGCGAGCTATGGGCGGCGCATAACCTGACTGCATATTGCTACCGATTC
AACACCAAGACAGACGATTACAACTGGGAAGAAGGCGTGGCGCATTTCTCGGACGTGATCTTCATCTTCAACAAC
CTTAATGGTTATGGGTTCAGTCCGAACCCGTTCACCAATGCTCCAGAGAGCTATACTGAGCTTAGTTACCTCATG
TCCGGCTCGTGGATCAGCTTCACTAATAGTCTGGATCCTAATAAGTGGACTGGTCGCGGAAGAAACGCTACGAAA
ACGGAGAATTGGCCCGTGTATGATCTGGAGAATCCCTTGAGTATGATCTGGGATGCGAATGTCACTTCGTATGCG
GCGCCGGATACTTGGCGTAAGGAGGGTATTGCGTTGATTAATGCTAATCGGAGGGCGTATCAGAGGTGA
Transcript >Ani_SJS72_1|g2363.t1
ATGCTCCCGACGCTTAGTTGGTTGGCCCTGGGCATGGCCAGTCTGGCAACCTGCACCGACCCAGTGGCCCAGACA
AAGAACGGAAGTTATTATGGTGTCTACATGCCTCAGTATAATGAGGATTATTTTCTTGGAATTCCATTTGCTAAG
CCCCCGTTGGCACACTTGCGTTGGGCCAACCCCGGGAGTCTTAATGAGTCTTGGTCGGGATTGCGCCCTGCTACC
GGCTATGCGATGAGCGAGGATTGTCTCTACCTAAACGTGGTCCGTCCCGCTGGATACGACAATGCCAGTCTTCCA
GTCCTTGTATGGATTCATGGTGGTGGCTTCGCACAAGGCAGCACTCCCGACCTCCGATACAATCTTACATTCATT
GTTAAGCACTCGCTCAATATCGACCAGCCAATTATCGCAGTGAGCGTTGCCTATCGTCTCGGTCCTTGGGGTTTC
TTCAATGGGGTCGAGCTCGCCAATGAGGGATCGTTAAATCTCGGGCTGAAGGACCAGCGCTTGGCTTTGCATTGG
GTGAAAGAGAACATTGCAGGTTTCGGTGGCGACCCTAGTAAAGTCGTGATTTACGGACAGAGTGCCGGCTCCGAA
AGCGTGGGATACCAAATCCGCGCGTACAACGGCCGAGATGACGGGCTTTTCCGCGGAGGCATGATGGAGTCCGGC
GCGGTGCTACCTGGCAGTGGCTTGAACCTCACCTGGACGTATGAGCCCTGGTTCCAGCAAATAGCAGACGAGGCA
GGATGTTCCCAGGCCATCCGCAAACTGGACTGTCTACGCCGCACGCCCTTCACAGTCCTCAACAACATCCTGAAC
ACGACCGCCAACAACACAACGCCTTACAACTGGAGGCCCACAGTGGACGCAACAACAACCTACGGCTGGGCCCTC
GACTCACAGGTAGTATCCTCGCTCTTGGACCTCTACCCCAACACCACCTCCTTCGGCATCCCATCATCCGAAGAA
CTCGGCGGCAACGTCACCTTCCCACAGCCCTACGGCGCCGCATTCCGCCAGACGGCCGCATACTACGGCGACGCC
CAGTTCATAGCCGCGACGCGCTACACCTGCGAGCTATGGGCGGCGCATAACCTGACTGCATATTGCTACCGATTC
AACACCAAGACAGACGATTACAACTGGGAAGAAGGCGTGGCGCATTTCTCGGACGTGATCTTCATCTTCAACAAC
CTTAATGGTTATGGGTTCAGTCCGAACCCGTTCACCAATGCTCCAGAGAGCTATACTGAGCTTAGTTACCTCATG
TCCGGCTCGTGGATCAGCTTCACTAATAGTCTGGATCCTAATAAGTGGACTGGTCGCGGAAGAAACGCTACGAAA
ACGGAGAATTGGCCCGTGTATGATCTGGAGAATCCCTTGAGTATGATCTGGGATGCGAATGTCACTTCGTATGCG
GCGCCGGATACTTGGCGTAAGGAGGGTATTGCGTTGATTAATGCTAATCGGAGGGCGTATCAGAGGTGA
Gene >Ani_SJS72_1|g2363.t1
ATGCTCCCGACGCTTAGTTGGTTGGCCCTGGGCATGGCCAGTCTGGCAACCTGCACCGACCCAGTGGCCCAGACA
AAGAACGGAAGTTATTATGGTGTCTACATGCCTCAGTATAATGAGGATTATTTTCTTGGAATTCCATTTGCTAAG
CCCCCGTTGGCACACTTGCGTTGGGCCAACCCCGGGAGTCTTAATGAGTCTTGGTCGGGATTGCGCCCTGCTACC
GGCTATGCGATGGTAAGTAGCCTGAACAGGCTGCTAAACGACCATGTACTTACTAACAGCGCGACTTATAGGAAT
GTATAGGTTACGGCAGTGATCAAAAAGGTTATCTTCAGGTGTGGATTGATGTCCCTTTCTTCACGCCGTTCTCTC
CTGACCAGCAAAACAGAGCGAGGATTGTCTCTACCTAAACGTGGTCCGTCCCGCTGGATACGACAATGCCAGTCT
TCCAGTCCTTGTATGGATTCATGGTATGTAGTAAAATCTACCCCCTCAATGACAAGTTACTCCCGACGCTGAATG
AACTAAACAGGTGGTGGCTTCGCACAAGGCAGCACTCCCGACCTCCGATACAATCTTACATTCATTGTTAAGCAC
TCGCTCAATATCGACCAGCCAATTATCGCAGTGAGCGTTGCCTATCGTCTCGGTCCTTGGGGTTTCTTCAATGGG
GTCGAGCTCGCCAATGAGGGATCGTTAAATCTCGGGCTGAAGGACCAGCGCTTGGCTTTGCATTGGGTGAAAGAG
AACATTGCAGGTTTCGGTGGTGGGTTTTCACAAAGCTGTTAAACGTACACAGTCCAAAGTTACTAATGACAGTCA
CTCCTATACAGGCGACCCTAGTAAAGTCGTGATTTACGGACAGAGTGCCGGCTCCGAAAGCGTGGGATACCAAAT
CCGCGCGTACAACGGCCGAGATGACGGGCTTTTCCGCGGAGGCATGATGGAGTCCGGCGCGGTGCTACCTGGCAG
TGGCTTGAACCTCACCTGGACGTATGAGCCCTGGTTCCAGCAAATAGCAGACGAGGCAGGATGTTCCCAGGCCAT
CCGCAAACTGGACTGTCTACGCCGCACGCCCTTCACAGTCCTCAACAACATCCTGAACACGACCGCCAACAACAC
AACGCCTTACAACTGGAGGCCCACAGTGGACGGTGACTTCGTAGCGCGGTATCCCAGCGAGCAACTCGACACAGG
AGACTTCGTCAAAGTACCAATCATAATTGGCTACACCACGGACGAAGGGACGACAGAGTGCCCAGAACCAGTGAA
CACCACCGCCGAATTAAAAGAATACCTCAGCTATACGTACTTGCCTCCTTCCTTCCTCCCTTATCCCCCCATCCC
CATCCCACTAACACCAACCCAGCAACAACAACCTACGGCTGGGCCCTCGACTCACAGGTAGTATCCTCGCTCTTG
GACCTCTACCCCAACACCACCTCCTTCGGCATCCCATCATCCGAAGAACTCGGCGGCAACGTCACCTTCCCACAG
CCCTACGGCGCCGCATTCCGCCAGACGGCCGCATACTACGGCGACGCCCAGTTCATAGCCGCGACGCGCTACACC
TGCGAGCTATGGGCGGCGCATAACCTGACTGCATATTGCTACCGATTCAACACCAAGACAGACGATTACAACTGG
GAAGAAGGCGTGGCGCATTTCTCGGACGTGATCTTCATCTTCAACAACCTTAATGGTTATGGGTTCAGTCCGAAC
CCGTTCACCAATGCTCCAGAGAGCTATACTGAGCTTAGTTACCTCATGTCCGGCTCGTGGATCAGCTTCACTAAT
AGTCTGGATCCTAATAAGTGGACTGGTCGCGGAAGAAACGCTACGAAAACGGAGAATTGGCCCGTGTATGATCTG
GAGAATCCCTTGAGTATGATCTGGGATGCGAATGTCACTTCGTATGCGGCGCCGGATACTTGGCGTAAGGAGGGT
ATTGCGTTGATTAATGCTAATCGGAGGGCGTATCAGAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail