Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g2199.t1
Gene name
Locationscaffold_011:526..2827
Strand+
Gene length (bp)2301
Transcript length (bp)2235
Coding sequence length (bp)2235
Protein length (aa) 745

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 3.5E-167 168 611
PF14558 TRP_N ML-like domain 7.6E-42 27 163

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 332 354 22
2 385 407 22
3 412 434 22
4 473 495 22
5 499 521 22
6 532 554 22
7 569 591 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g2199.t1
MRLISMFIGLLVVLLNSPQAAAVKLIESNALSICQDSSNFTATYFSVTFTPGNRSLTFSFDGVSAISGKVTAELV
LEAYGIQVLTKTLDPCEMDLTGLCPMNAGTIDVPKAVITVPESVVKSIPNIAYTVPDLDANVRIYINSTTTGEAI
TCVEASLSNGKTVYQKGVGWTTAIISGLGLAASAITSGLGHSNTAAHVAANALSLFGFMQSQAMIGMTSVAMPPI
VESWTQNFQWSMGIIHVGFLETICTWYQRSTGGTASTLLSDLSTTSVQLYRRKRSLDDEPIVRKATGYFKHWQKR
SDASTQTATDSSVIVRGIERVGFKAGIETTNIFLTGLIFFVVFVALVMALVAVFKLGCEVLAKNGKMKGDKFQEF
RNGWKVVARGILFRLTLIGFPQMCVLCLWEFTRVDSAAEVVLAVIMFLSVVAALGWAALKVLRLAKRSVIMHKNP
AYILYSDPTCLNKWGFLYVQYRATAYYFIVPFLGYILIKGLFIGLSQPAPVVQTIALVIIEAAMLIAVSVLRPWM
DKKTNIYNISIAAINFLNTIFLLFFSDVFNQPGIVTGVMGVVFFVYNAVFALVLLILVLIASVYAIVSKNPDTRY
QPMRDDRGSFIKNGGQLTTELDALGATARGDMKGSPYQSSPFEDDNTSFSSGNGASVSRQNLEAPDAQTHQTARH
SPVSPVDPSLPLFPSDTSARNGPPAYDANFGRSPSPVPRNYNSSPFQNPHAYRQQNNPSPWQRGAGYDH*
Coding >Ani_SJS72_1|g2199.t1
ATGCGATTAATATCCATGTTCATCGGCCTTCTGGTCGTCCTGCTCAACTCCCCGCAGGCGGCCGCCGTCAAGCTC
ATCGAGTCCAATGCTCTTAGTATTTGCCAGGACAGTTCGAATTTCACGGCCACTTACTTCAGTGTTACATTCACA
CCCGGAAACCGCTCGCTCACCTTCAGCTTCGATGGAGTGTCTGCAATTTCTGGAAAGGTCACTGCAGAGCTCGTG
CTCGAGGCCTACGGTATCCAGGTGTTGACCAAGACTCTCGACCCCTGTGAGATGGATCTTACTGGACTCTGTCCC
ATGAATGCAGGCACGATCGATGTTCCGAAAGCCGTCATTACCGTGCCTGAGTCGGTGGTCAAGTCTATTCCAAAC
ATTGCATACACCGTCCCGGATCTTGATGCCAACGTGCGGATCTATATCAACTCTACCACCACCGGTGAAGCCATT
ACCTGTGTGGAAGCATCCCTCTCCAACGGCAAGACAGTTTATCAAAAGGGTGTCGGCTGGACTACAGCCATTATC
TCCGGTCTCGGTCTTGCTGCCTCTGCTATCACCTCTGGATTAGGACATTCGAACACGGCTGCTCACGTCGCGGCT
AATGCGCTCTCGCTCTTCGGTTTCATGCAGTCTCAAGCGATGATTGGTATGACATCCGTCGCCATGCCTCCGATC
GTGGAGTCTTGGACCCAGAATTTCCAGTGGAGTATGGGTATCATCCATGTGGGCTTCCTGGAAACTATCTGTACA
TGGTATCAGCGCTCGACTGGAGGGACGGCTTCGACCCTTCTTTCGGACTTGTCCACTACGTCCGTTCAACTCTAC
AGACGCAAGCGCTCCCTCGATGATGAGCCCATTGTCCGGAAGGCCACTGGGTATTTCAAGCATTGGCAGAAACGT
TCGGATGCCAGTACCCAGACTGCCACGGATTCTAGCGTCATTGTTCGTGGTATTGAGCGTGTTGGTTTCAAGGCT
GGAATTGAAACCACCAACATCTTCCTTACCGGTCTTATCTTCTTCGTTGTATTCGTTGCGCTGGTGATGGCCCTA
GTTGCTGTTTTCAAGCTTGGCTGTGAGGTCCTTGCTAAGAACGGCAAGATGAAGGGGGATAAATTCCAAGAGTTC
CGTAACGGATGGAAGGTTGTCGCACGTGGAATCCTGTTCCGACTTACGCTGATCGGCTTCCCCCAAATGTGTGTA
CTCTGCCTGTGGGAATTCACTCGGGTAGACTCAGCTGCGGAGGTGGTTCTTGCTGTGATCATGTTCCTTTCGGTG
GTTGCAGCGCTGGGCTGGGCAGCATTGAAGGTGTTGCGTCTGGCCAAGCGATCTGTCATCATGCACAAGAACCCG
GCTTATATCCTCTACTCTGACCCTACCTGCCTGAATAAGTGGGGCTTCTTGTATGTCCAGTACCGCGCAACTGCG
TACTACTTCATTGTCCCGTTCTTGGGCTACATCCTGATCAAGGGCCTTTTCATTGGCTTGAGTCAGCCCGCCCCG
GTCGTGCAAACCATCGCCCTCGTCATCATTGAAGCTGCTATGCTCATTGCTGTCAGCGTCCTCCGGCCCTGGATG
GACAAGAAGACCAATATCTACAACATTTCGATTGCCGCCATTAACTTCCTCAACACGATTTTCCTGCTATTCTTC
TCGGATGTGTTCAACCAACCCGGAATTGTCACTGGTGTTATGGGTGTTGTTTTCTTCGTCTACAACGCTGTCTTT
GCTCTGGTGTTGTTGATTCTGGTCTTGATCGCATCTGTTTACGCCATCGTTTCCAAGAACCCCGACACGCGGTAC
CAGCCCATGAGAGATGACCGGGGTTCGTTCATTAAGAACGGGGGTCAGTTGACCACCGAACTGGATGCTCTGGGT
GCTACCGCCCGTGGAGACATGAAGGGGTCGCCGTACCAATCCAGTCCGTTTGAGGATGACAACACGTCCTTCTCG
AGCGGAAACGGTGCCAGTGTTAGCCGCCAGAATCTCGAAGCCCCTGATGCTCAGACACACCAGACCGCTCGTCAT
TCCCCGGTTTCCCCTGTCGACCCGTCTTTGCCGCTGTTCCCCAGCGACACCTCGGCCCGCAATGGCCCTCCTGCC
TACGATGCTAATTTCGGGCGTTCGCCGTCTCCTGTACCACGGAACTACAACAGCTCCCCCTTCCAAAACCCACAT
GCATACCGGCAACAAAACAACCCGAGCCCATGGCAACGGGGAGCAGGTTATGACCACTGA
Transcript >Ani_SJS72_1|g2199.t1
ATGCGATTAATATCCATGTTCATCGGCCTTCTGGTCGTCCTGCTCAACTCCCCGCAGGCGGCCGCCGTCAAGCTC
ATCGAGTCCAATGCTCTTAGTATTTGCCAGGACAGTTCGAATTTCACGGCCACTTACTTCAGTGTTACATTCACA
CCCGGAAACCGCTCGCTCACCTTCAGCTTCGATGGAGTGTCTGCAATTTCTGGAAAGGTCACTGCAGAGCTCGTG
CTCGAGGCCTACGGTATCCAGGTGTTGACCAAGACTCTCGACCCCTGTGAGATGGATCTTACTGGACTCTGTCCC
ATGAATGCAGGCACGATCGATGTTCCGAAAGCCGTCATTACCGTGCCTGAGTCGGTGGTCAAGTCTATTCCAAAC
ATTGCATACACCGTCCCGGATCTTGATGCCAACGTGCGGATCTATATCAACTCTACCACCACCGGTGAAGCCATT
ACCTGTGTGGAAGCATCCCTCTCCAACGGCAAGACAGTTTATCAAAAGGGTGTCGGCTGGACTACAGCCATTATC
TCCGGTCTCGGTCTTGCTGCCTCTGCTATCACCTCTGGATTAGGACATTCGAACACGGCTGCTCACGTCGCGGCT
AATGCGCTCTCGCTCTTCGGTTTCATGCAGTCTCAAGCGATGATTGGTATGACATCCGTCGCCATGCCTCCGATC
GTGGAGTCTTGGACCCAGAATTTCCAGTGGAGTATGGGTATCATCCATGTGGGCTTCCTGGAAACTATCTGTACA
TGGTATCAGCGCTCGACTGGAGGGACGGCTTCGACCCTTCTTTCGGACTTGTCCACTACGTCCGTTCAACTCTAC
AGACGCAAGCGCTCCCTCGATGATGAGCCCATTGTCCGGAAGGCCACTGGGTATTTCAAGCATTGGCAGAAACGT
TCGGATGCCAGTACCCAGACTGCCACGGATTCTAGCGTCATTGTTCGTGGTATTGAGCGTGTTGGTTTCAAGGCT
GGAATTGAAACCACCAACATCTTCCTTACCGGTCTTATCTTCTTCGTTGTATTCGTTGCGCTGGTGATGGCCCTA
GTTGCTGTTTTCAAGCTTGGCTGTGAGGTCCTTGCTAAGAACGGCAAGATGAAGGGGGATAAATTCCAAGAGTTC
CGTAACGGATGGAAGGTTGTCGCACGTGGAATCCTGTTCCGACTTACGCTGATCGGCTTCCCCCAAATGTGTGTA
CTCTGCCTGTGGGAATTCACTCGGGTAGACTCAGCTGCGGAGGTGGTTCTTGCTGTGATCATGTTCCTTTCGGTG
GTTGCAGCGCTGGGCTGGGCAGCATTGAAGGTGTTGCGTCTGGCCAAGCGATCTGTCATCATGCACAAGAACCCG
GCTTATATCCTCTACTCTGACCCTACCTGCCTGAATAAGTGGGGCTTCTTGTATGTCCAGTACCGCGCAACTGCG
TACTACTTCATTGTCCCGTTCTTGGGCTACATCCTGATCAAGGGCCTTTTCATTGGCTTGAGTCAGCCCGCCCCG
GTCGTGCAAACCATCGCCCTCGTCATCATTGAAGCTGCTATGCTCATTGCTGTCAGCGTCCTCCGGCCCTGGATG
GACAAGAAGACCAATATCTACAACATTTCGATTGCCGCCATTAACTTCCTCAACACGATTTTCCTGCTATTCTTC
TCGGATGTGTTCAACCAACCCGGAATTGTCACTGGTGTTATGGGTGTTGTTTTCTTCGTCTACAACGCTGTCTTT
GCTCTGGTGTTGTTGATTCTGGTCTTGATCGCATCTGTTTACGCCATCGTTTCCAAGAACCCCGACACGCGGTAC
CAGCCCATGAGAGATGACCGGGGTTCGTTCATTAAGAACGGGGGTCAGTTGACCACCGAACTGGATGCTCTGGGT
GCTACCGCCCGTGGAGACATGAAGGGGTCGCCGTACCAATCCAGTCCGTTTGAGGATGACAACACGTCCTTCTCG
AGCGGAAACGGTGCCAGTGTTAGCCGCCAGAATCTCGAAGCCCCTGATGCTCAGACACACCAGACCGCTCGTCAT
TCCCCGGTTTCCCCTGTCGACCCGTCTTTGCCGCTGTTCCCCAGCGACACCTCGGCCCGCAATGGCCCTCCTGCC
TACGATGCTAATTTCGGGCGTTCGCCGTCTCCTGTACCACGGAACTACAACAGCTCCCCCTTCCAAAACCCACAT
GCATACCGGCAACAAAACAACCCGAGCCCATGGCAACGGGGAGCAGGTTATGACCACTGA
Gene >Ani_SJS72_1|g2199.t1
ATGCGATTAATATCCATGTTCATCGGCCTTCTGGTCGTCCTGCTCAACTCCCCGCAGGCGGCCGCCGTCAAGCTC
ATCGAGTCCAATGCTCTTAGTATTTGCCAGGACAGTTCGAATTTCACGGCCACTTACTTCAGTGTTACATTCACA
CCCGGAAACCGCTCGCTCACCTTCAGCTTCGATGGAGTGTCTGCAATTTCTGGAAAGGTCACTGCAGAGCTCGTG
CTCGAGGCCTACGGTATCCAGGTGTTGACCAAGACTCTCGACCCCTGTGAGATGGATCTTACTGGACTCTGTCCC
ATGAATGCAGGCACGATCGATGTTCCGAAAGCCGTCATTACCGTGCCTGAGTCGGTGGTCAAGTCTATTCCAAGT
AAGTGATCTCCGCCATCGGCGGCCCCTTCGAGTGAGCCCTAGTTCACTGACAATTTGCGCGTAGACATTGCATAC
ACCGTCCCGGATCTTGATGCCAACGTGCGGATCTATATCAACTCTACCACCACCGGTGAAGCCATTACCTGTGTG
GAAGCATCCCTCTCCAACGGCAAGACAGTTTATCAAAAGGGTGTCGGCTGGACTACAGCCATTATCTCCGGTCTC
GGTCTTGCTGCCTCTGCTATCACCTCTGGATTAGGACATTCGAACACGGCTGCTCACGTCGCGGCTAATGCGCTC
TCGCTCTTCGGTTTCATGCAGTCTCAAGCGATGATTGGTATGACATCCGTCGCCATGCCTCCGATCGTGGAGTCT
TGGACCCAGAATTTCCAGTGGAGTATGGGTATCATCCATGTGGGCTTCCTGGAAACTATCTGTACATGGTATCAG
CGCTCGACTGGAGGGACGGCTTCGACCCTTCTTTCGGACTTGTCCACTACGTCCGTTCAACTCTACAGACGCAAG
CGCTCCCTCGATGATGAGCCCATTGTCCGGAAGGCCACTGGGTATTTCAAGCATTGGCAGAAACGTTCGGATGCC
AGTACCCAGACTGCCACGGATTCTAGCGTCATTGTTCGTGGTATTGAGCGTGTTGGTTTCAAGGCTGGAATTGAA
ACCACCAACATCTTCCTTACCGGTCTTATCTTCTTCGTTGTATTCGTTGCGCTGGTGATGGCCCTAGTTGCTGTT
TTCAAGCTTGGCTGTGAGGTCCTTGCTAAGAACGGCAAGATGAAGGGGGATAAATTCCAAGAGTTCCGTAACGGA
TGGAAGGTTGTCGCACGTGGAATCCTGTTCCGACTTACGCTGATCGGCTTCCCCCAAATGTGTGTACTCTGCCTG
TGGGAATTCACTCGGGTAGACTCAGCTGCGGAGGTGGTTCTTGCTGTGATCATGTTCCTTTCGGTGGTTGCAGCG
CTGGGCTGGGCAGCATTGAAGGTGTTGCGTCTGGCCAAGCGATCTGTCATCATGCACAAGAACCCGGCTTATATC
CTCTACTCTGACCCTACCTGCCTGAATAAGTGGGGCTTCTTGTATGTCCAGTACCGCGCAACTGCGTACTACTTC
ATTGTCCCGTTCTTGGGCTACATCCTGATCAAGGGCCTTTTCATTGGCTTGAGTCAGCCCGCCCCGGTCGTGCAA
ACCATCGCCCTCGTCATCATTGAAGCTGCTATGCTCATTGCTGTCAGCGTCCTCCGGCCCTGGATGGACAAGAAG
ACCAATATCTACAACATTTCGATTGCCGCCATTAACTTCCTCAACACGATTTTCCTGCTATTCTTCTCGGATGTG
TTCAACCAACCCGGAATTGTCACTGGTGTTATGGGTGTTGTTTTCTTCGTCTACAACGCTGTCTTTGCTCTGGTG
TTGTTGATTCTGGTCTTGATCGCATCTGTTTACGCCATCGTTTCCAAGAACCCCGACACGCGGTACCAGCCCATG
AGAGATGACCGGGGTTCGTTCATTAAGAACGGGGGTCAGTTGACCACCGAACTGGATGCTCTGGGTGCTACCGCC
CGTGGAGACATGAAGGGGTCGCCGTACCAATCCAGTCCGTTTGAGGATGACAACACGTCCTTCTCGAGCGGAAAC
GGTGCCAGTGTTAGCCGCCAGAATCTCGAAGCCCCTGATGCTCAGACACACCAGACCGCTCGTCATTCCCCGGTT
TCCCCTGTCGACCCGTCTTTGCCGCTGTTCCCCAGCGACACCTCGGCCCGCAATGGCCCTCCTGCCTACGATGCT
AATTTCGGGCGTTCGCCGTCTCCTGTACCACGGAACTACAACAGCTCCCCCTTCCAAAACCCACATGCATACCGG
CAACAAAACAACCCGAGCCCATGGCAACGGGGAGCAGGTTATGACCACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail