Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g2183.t1
Gene name
Locationscaffold_010:448933..450849
Strand-
Gene length (bp)1916
Transcript length (bp)1821
Coding sequence length (bp)1821
Protein length (aa) 607

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04922 DIE2_ALG10 DIE2/ALG10 family 1.4E-127 35 537

GO

GO Term Description Terminal node
GO:0006488 dolichol-linked oligosaccharide biosynthetic process Yes
GO:0106073 dolichyl pyrophosphate Glc2Man9GlcNAc2 alpha-1,2-glucosyltransferase activity Yes
GO:0006629 lipid metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0046527 glucosyltransferase activity No
GO:0006490 oligosaccharide-lipid intermediate biosynthetic process No
GO:0016758 hexosyltransferase activity No
GO:0044255 cellular lipid metabolic process No
GO:0009058 biosynthetic process No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0016757 glycosyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 64 86 22
3 141 163 22
4 178 196 18
5 269 291 22
6 315 337 22
7 363 385 22
8 405 427 22
9 503 525 22
10 573 595 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g2183.t1
MNAQPKSGVALAARYTIPFVLLLIPFWMTRINAVVPEPYLDEAFHVPQAQAYWAHKWTHWDPKITTPPGLYLWSY
VLCAIALFLRGSPTQLTPEALRATNVAATAVALPLRLQTLLDRLRKVRNTRPSGAWLSHTVLNICLFPPLFFFSG
LYYTDILALLVVIEAYNWDLKRSSQGGFAPLQTLVFVVLGLVALVFRQTNIFWVAIFLGGLQVVRRLRLSSKRCE
ASGFADIAQAGWKNELYDPFVSEASIGDYFKASVSLVVVAVNNLGTVISSALPYLLILAGFGGFVLWNDGVVLGH
KEYHTAGLHLPQMLYIWPYFVFFSWPLLLSPVANLVLPKSLLPKFIDFGFPKKQKGLPKLLTALVVIPIMLAVVH
FNTIVHPFTLADNRHYVFYVFRILLRIHPAIKYAAVAVYFLCAWMVISAFGFSTTTTPPQLMRVPQTAAPQPEPV
PQKEPSQKKAERRKAAKKPAQPPKPEPISFEAYARIQEHIAHRQKQHQGAPQVSFVLVWLAATALSLITAPLVEP
RYFIIPWVMWRLHLPPQPTPLVHRQRARDATEELNAKVATNMALFLETYWFLVINAVTGYIFLYCGFEWPQEPGK
IQRFMW*
Coding >Ani_SJS72_1|g2183.t1
ATGAATGCGCAACCCAAGTCGGGCGTGGCATTGGCCGCCCGCTACACCATACCTTTTGTTCTGCTGTTGATCCCC
TTTTGGATGACGAGGATCAATGCCGTCGTTCCCGAACCGTATCTGGATGAGGCCTTCCATGTCCCCCAGGCTCAG
GCCTACTGGGCTCATAAGTGGACGCATTGGGATCCCAAGATCACCACTCCCCCGGGACTTTATCTTTGGTCCTAT
GTGCTGTGCGCGATCGCGCTCTTCCTGCGCGGTTCCCCAACGCAGCTTACACCGGAAGCTTTGCGTGCGACCAAC
GTGGCAGCCACCGCCGTGGCTCTGCCGTTGCGATTGCAGACGTTGTTGGATCGGCTGCGCAAGGTACGCAACACG
CGTCCCTCTGGAGCATGGCTAAGCCATACCGTTCTGAACATCTGCCTGTTCCCGCCGCTGTTCTTCTTCTCCGGC
CTATACTATACCGATATTCTTGCGCTGCTGGTGGTCATTGAGGCGTACAACTGGGACCTGAAACGCTCGTCGCAG
GGTGGCTTTGCCCCGCTTCAGACTTTGGTGTTTGTCGTGCTGGGGCTGGTGGCGCTGGTCTTCAGACAGACGAAC
ATCTTCTGGGTGGCGATCTTCCTGGGTGGGCTGCAGGTCGTGCGGCGGTTGCGGTTGTCTTCTAAGAGATGCGAG
GCGTCGGGATTCGCGGATATTGCTCAGGCAGGGTGGAAGAACGAGCTGTATGATCCGTTTGTGTCGGAAGCTTCA
ATTGGAGACTACTTCAAAGCGTCTGTTTCGCTGGTGGTTGTTGCCGTGAACAACCTCGGCACGGTGATTAGCTCT
GCTCTTCCGTACTTGCTTATACTTGCTGGGTTTGGAGGGTTCGTGCTGTGGAATGATGGGGTCGTTCTTGGACAC
AAGGAGTACCATACTGCTGGGCTGCATCTGCCCCAGATGCTCTACATCTGGCCCTACTTCGTCTTCTTCTCATGG
CCTCTCCTCCTGTCGCCGGTCGCCAACCTGGTTCTTCCGAAGTCGCTTCTGCCCAAGTTTATCGACTTTGGCTTC
CCGAAGAAGCAAAAGGGCCTTCCTAAGCTGTTGACGGCTCTTGTTGTTATTCCCATCATGCTGGCTGTGGTCCAC
TTCAACACCATCGTCCATCCCTTTACCCTGGCCGACAACCGTCACTATGTCTTTTACGTCTTCCGCATCCTTCTG
CGCATTCACCCGGCTATCAAGTATGCTGCTGTCGCAGTGTACTTCCTCTGCGCGTGGATGGTCATTTCCGCCTTT
GGATTCTCAACGACTACCACGCCTCCCCAGTTGATGCGTGTCCCGCAGACAGCAGCCCCTCAGCCTGAGCCAGTG
CCGCAGAAAGAACCCAGCCAGAAGAAGGCCGAGCGTCGAAAGGCAGCTAAGAAACCCGCACAGCCGCCCAAGCCG
GAGCCGATCTCTTTTGAGGCGTACGCCAGGATCCAGGAGCACATTGCGCACCGGCAGAAGCAGCACCAGGGCGCG
CCGCAGGTAAGCTTTGTGCTTGTCTGGTTGGCGGCCACGGCACTGTCGCTCATCACGGCGCCGCTTGTCGAGCCG
CGATACTTTATCATTCCGTGGGTGATGTGGCGGCTGCATCTGCCCCCGCAGCCGACGCCCCTCGTGCACCGTCAG
CGGGCGCGCGATGCGACTGAGGAGCTCAACGCGAAGGTTGCCACGAACATGGCGCTGTTCCTGGAGACGTATTGG
TTCTTGGTGATCAATGCGGTGACGGGATACATCTTCCTGTACTGCGGGTTCGAATGGCCCCAGGAACCGGGGAAG
ATTCAGCGCTTCATGTGGTAG
Transcript >Ani_SJS72_1|g2183.t1
ATGAATGCGCAACCCAAGTCGGGCGTGGCATTGGCCGCCCGCTACACCATACCTTTTGTTCTGCTGTTGATCCCC
TTTTGGATGACGAGGATCAATGCCGTCGTTCCCGAACCGTATCTGGATGAGGCCTTCCATGTCCCCCAGGCTCAG
GCCTACTGGGCTCATAAGTGGACGCATTGGGATCCCAAGATCACCACTCCCCCGGGACTTTATCTTTGGTCCTAT
GTGCTGTGCGCGATCGCGCTCTTCCTGCGCGGTTCCCCAACGCAGCTTACACCGGAAGCTTTGCGTGCGACCAAC
GTGGCAGCCACCGCCGTGGCTCTGCCGTTGCGATTGCAGACGTTGTTGGATCGGCTGCGCAAGGTACGCAACACG
CGTCCCTCTGGAGCATGGCTAAGCCATACCGTTCTGAACATCTGCCTGTTCCCGCCGCTGTTCTTCTTCTCCGGC
CTATACTATACCGATATTCTTGCGCTGCTGGTGGTCATTGAGGCGTACAACTGGGACCTGAAACGCTCGTCGCAG
GGTGGCTTTGCCCCGCTTCAGACTTTGGTGTTTGTCGTGCTGGGGCTGGTGGCGCTGGTCTTCAGACAGACGAAC
ATCTTCTGGGTGGCGATCTTCCTGGGTGGGCTGCAGGTCGTGCGGCGGTTGCGGTTGTCTTCTAAGAGATGCGAG
GCGTCGGGATTCGCGGATATTGCTCAGGCAGGGTGGAAGAACGAGCTGTATGATCCGTTTGTGTCGGAAGCTTCA
ATTGGAGACTACTTCAAAGCGTCTGTTTCGCTGGTGGTTGTTGCCGTGAACAACCTCGGCACGGTGATTAGCTCT
GCTCTTCCGTACTTGCTTATACTTGCTGGGTTTGGAGGGTTCGTGCTGTGGAATGATGGGGTCGTTCTTGGACAC
AAGGAGTACCATACTGCTGGGCTGCATCTGCCCCAGATGCTCTACATCTGGCCCTACTTCGTCTTCTTCTCATGG
CCTCTCCTCCTGTCGCCGGTCGCCAACCTGGTTCTTCCGAAGTCGCTTCTGCCCAAGTTTATCGACTTTGGCTTC
CCGAAGAAGCAAAAGGGCCTTCCTAAGCTGTTGACGGCTCTTGTTGTTATTCCCATCATGCTGGCTGTGGTCCAC
TTCAACACCATCGTCCATCCCTTTACCCTGGCCGACAACCGTCACTATGTCTTTTACGTCTTCCGCATCCTTCTG
CGCATTCACCCGGCTATCAAGTATGCTGCTGTCGCAGTGTACTTCCTCTGCGCGTGGATGGTCATTTCCGCCTTT
GGATTCTCAACGACTACCACGCCTCCCCAGTTGATGCGTGTCCCGCAGACAGCAGCCCCTCAGCCTGAGCCAGTG
CCGCAGAAAGAACCCAGCCAGAAGAAGGCCGAGCGTCGAAAGGCAGCTAAGAAACCCGCACAGCCGCCCAAGCCG
GAGCCGATCTCTTTTGAGGCGTACGCCAGGATCCAGGAGCACATTGCGCACCGGCAGAAGCAGCACCAGGGCGCG
CCGCAGGTAAGCTTTGTGCTTGTCTGGTTGGCGGCCACGGCACTGTCGCTCATCACGGCGCCGCTTGTCGAGCCG
CGATACTTTATCATTCCGTGGGTGATGTGGCGGCTGCATCTGCCCCCGCAGCCGACGCCCCTCGTGCACCGTCAG
CGGGCGCGCGATGCGACTGAGGAGCTCAACGCGAAGGTTGCCACGAACATGGCGCTGTTCCTGGAGACGTATTGG
TTCTTGGTGATCAATGCGGTGACGGGATACATCTTCCTGTACTGCGGGTTCGAATGGCCCCAGGAACCGGGGAAG
ATTCAGCGCTTCATGTGGTAG
Gene >Ani_SJS72_1|g2183.t1
ATGAATGCGCAACCCAAGTCGGGCGTGGCATTGGCCGCCCGCTACACCATACCTTTTGTTCTGCTGTTGATCCCC
TTTTGGATGACGAGGATCAATGCCGTCGTTCCCGAACCGTATCTGGATGAGGCCTTCCATGTCCCCCAGGCTCAG
GCCTACTGGGCTCATAAGTGGACGCATTGGGATCCCAAGATCACCACTCCCCCGGGACTTTATCTTTGGTCCTAT
GTGCTGTGCGCGATCGCGCTCTTCCTGCGCGGTTCCCCAACGCAGCTTACACCGGAAGCTTTGCGTGCGACCAAC
GTGGCAGCCACCGCCGTGGCTCTGCCGTTGCGATTGCAGACGTTGTTGGATCGGCTGCGCAAGGTACGCAACACG
CGTCCCTCTGGAGCATGGCTAAGCCATACCGTTCTGAACATCTGCCTGTTCCCGCCGCTGTTCTTCTTCTCCGGC
CTATACTATACCGATATTCTTGCGCTGCTGGTGGTCATTGAGGCGTACAACTGGGACCTGAAACGCTCGTCGCAG
GGTGGCTTTGCCCCGCTTCAGACTTTGGTGTTTGTCGTGCTGGGGCTGGTGGCGCTGGTCTTCAGACAGACGAAC
ATCTTCTGGGTGGCGATCTTCCTGGGTGGGCTGCAGGTCGTGCGGCGGTTGCGGTTGTCTTCTAAGAGATGCGAG
GCGTCGGGATTCGCGGATATTGCTCAGGCAGGGTGGAAGAACGAGCTGTATGATCCGTTTGTGTCGGAAGCTTCA
ATTGGAGGTTAGTGTTGTCGTTGTGGTGTGTTGTAGCATTGCTGACTGAGGTAGACTACTTCAAAGCGTCTGTTT
CGCTGGTGGTTGTTGCCGTGAACAACCTCGGCACGGTGATTAGCTCTGCTCTTCCGTACTTGCTTATACTTGCTG
GGTTTGGAGGGTTCGTGCTGTGGAATGATGGGGTCGTTCTTGGTAGGTCTACTACGGGTTGTGTTGCAGGTGCTA
GGCTGACAACTGCAGGACACAAGGAGTACCATACTGCTGGGCTGCATCTGCCCCAGATGCTCTACATCTGGCCCT
ACTTCGTCTTCTTCTCATGGCCTCTCCTCCTGTCGCCGGTCGCCAACCTGGTTCTTCCGAAGTCGCTTCTGCCCA
AGTTTATCGACTTTGGCTTCCCGAAGAAGCAAAAGGGCCTTCCTAAGCTGTTGACGGCTCTTGTTGTTATTCCCA
TCATGCTGGCTGTGGTCCACTTCAACACCATCGTCCATCCCTTTACCCTGGCCGACAACCGTCACTATGTCTTTT
ACGTCTTCCGCATCCTTCTGCGCATTCACCCGGCTATCAAGTATGCTGCTGTCGCAGTGTACTTCCTCTGCGCGT
GGATGGTCATTTCCGCCTTTGGATTCTCAACGACTACCACGCCTCCCCAGTTGATGCGTGTCCCGCAGACAGCAG
CCCCTCAGCCTGAGCCAGTGCCGCAGAAAGAACCCAGCCAGAAGAAGGCCGAGCGTCGAAAGGCAGCTAAGAAAC
CCGCACAGCCGCCCAAGCCGGAGCCGATCTCTTTTGAGGCGTACGCCAGGATCCAGGAGCACATTGCGCACCGGC
AGAAGCAGCACCAGGGCGCGCCGCAGGTAAGCTTTGTGCTTGTCTGGTTGGCGGCCACGGCACTGTCGCTCATCA
CGGCGCCGCTTGTCGAGCCGCGATACTTTATCATTCCGTGGGTGATGTGGCGGCTGCATCTGCCCCCGCAGCCGA
CGCCCCTCGTGCACCGTCAGCGGGCGCGCGATGCGACTGAGGAGCTCAACGCGAAGGTTGCCACGAACATGGCGC
TGTTCCTGGAGACGTATTGGTTCTTGGTGATCAATGCGGTGACGGGATACATCTTCCTGTACTGCGGGTTCGAAT
GGCCCCAGGAACCGGGGAAGATTCAGCGCTTCATGTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail