Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g2057.t1
Gene name
Locationscaffold_010:49459..55434
Strand-
Gene length (bp)5975
Transcript length (bp)4935
Coding sequence length (bp)4935
Protein length (aa) 1645

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00443 UCH Ubiquitin carboxyl-terminal hydrolase 2.2E-77 681 1410
PF06337 DUSP DUSP domain 7.9E-13 344 446

GO

GO Term Description Terminal node
GO:0016579 protein deubiquitination Yes
GO:0004843 cysteine-type deubiquitinase activity Yes
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0101005 deubiquitinase activity No
GO:0008152 metabolic process No
GO:0043412 macromolecule modification No
GO:0006508 proteolysis No
GO:0008233 peptidase activity No
GO:0070646 protein modification by small protein removal No
GO:0070647 protein modification by small protein conjugation or removal No
GO:0019538 protein metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0019783 ubiquitin-like protein peptidase activity No
GO:0071704 organic substance metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008234 cysteine-type peptidase activity No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g2057.t1
MSIDLVLLAANVRICLADQEGVPSRDWLLTALSDWQPGYLINKVSYTECIVSLVTVCQSEMNGLTKRFRSFCIAT
LLVSSSVSNPSTVLPRAATKRAQLTVTTSSTKRRKVAEPRRPGSLPGLSFASQAGRRHGHSSSDKASPSRSSRHP
SSPSRSHRSTQSSSASPPPRYIPAHLQDEVLASKSQSTARSPTPDSAGSVLDYPAAACAGLTLHSDPATDMSGSD
DKGDSNLPLAGSDARETSASENEVNDVEMDLVPTEKDSQTRSDHPDSMETTTSGDDNVTNSASDSVYPTPSSMST
YTAPTETRAHSKAEAGVASADRPSYDDQVAQVTQFMMQPMKEKQKGYVVSNSWLKRVYSRSATHADKADKTAMEG
DIGPVDNSDIVLVTDPANTGFKDEEGEPFVPLRPGLELGEDFEIIPQGGWDLIMQWYGLAEQSPAIVRYVHNTAA
VGDQENLQYEINPPIFTILKLTNPSAGTSIKTMKEKTMAPVRTLASRHTNFQKWLKNAKELAQIDMSTKVRVWRI
LGGLGSATASAAATPAASRSASPAPSASLIANAGSNLVLDLNTFLSLSEGSQREVLDEPKDQTNNPNYNGKMTLG
VAGLNSSEIIVLEEKLPGTSGEWVSEASKQTLNRLGVPSGSLKNGAPAKVKTKSPATSGRSSPVSEPIRGRRKDG
KPRGCTGLSNLGNTCYMNSALQCVRSVEELTYYFLNDVYKKDLNPSNPLAHNGDVAKAYANMLRQMYDEAGQSSF
APRQLKHTIGRYGPAFSGYGQQDSQEFLLFLLDGLQEDLNRIMKKPYIEKPDSTDEMVHNKEALAEFADKCWDIY
KARNDSVITDLFAGMYKSTLVCPACDKVSIIFDPFNNLTLQLPIENLWGKEIFYFPLNKKPVLVDVEIDKNASVK
ALKEQVAKKMGTDPERLVMAEIYKNKFYKMFDNTSSIAECQISGNDDIGIYEVESVPTNYNPDKPQKSYFSFSRS
DHEEIPSLDSPRSDRLLVPIFNRVEKKRGNNPKNAQRSLFGVPSYVVINREEFGDYDTIFRKVLSQVASMSTRDF
LNEENTTEVSHEDSDTVIMNEDDAESADSKIKTASVDGEDGMVDVSMRDADDSSSDAPARSESAISPNLRGLFEM
KIIKSSSEVVPTGWSTVDDHKEYPKMSFRIKTPVKKQKQSVDSTNGTEQKDEESGDKSSDSASGESASKPKAQDR
PMIRPGEGIVVDWTEQAHDALFAGSSRDKNSLRGAPTWTDVERVPDPELSKRRTLRQNRKKRGVTLYECLDEFNK
EEVLSENDAWYCPRCKEHRRASKKFELWKTPDILVMHLKRFSASRGFRDKLDVLVDFPVEGLDMTGRVEAPEEGK
SQIYDLFAVDNHYGGLGGGHYTAYAKNFFTGQWNEYNDSSVSRPIDPQSVVTSSAYLLFYRRRSDRPLGGKVLEE
ITEASTRPNSDVDSQTESRGQSPSGEGRRLGGSSRNGSSSALTGVGAAHQSGDGGLPTGTQTKSGDDDWPPGYTN
VPSFGEQSLDRATQSEGMNFEDEEIGGGMQPSPFRPQDDTPSWSFSRATDAHGPSQMTTVPTDDEDLLDDDASNQ
AVGGGDVSDPDLRMASLMDSPRGAAYPGTPMEETSFPDISAFAADGDDDEEDELPVVELQVHDEDQTLP*
Coding >Ani_SJS72_1|g2057.t1
ATGTCGATTGATCTTGTGTTACTCGCGGCGAATGTGAGGATTTGCCTTGCAGACCAGGAAGGGGTGCCAAGTCGC
GATTGGTTGTTGACGGCATTGTCCGACTGGCAACCGGGATATCTCATCAACAAAGTGTCATACACTGAGTGCATT
GTCTCTCTTGTGACCGTTTGTCAAAGTGAAATGAACGGACTGACTAAACGTTTTCGTTCCTTTTGCATCGCTACT
CTTCTAGTGTCGAGCTCAGTTTCCAACCCATCTACCGTGCTACCTCGAGCTGCCACGAAACGTGCGCAGCTCACC
GTCACGACGTCTTCCACAAAGCGCCGTAAAGTAGCAGAGCCTCGCAGACCAGGATCGCTTCCGGGTTTGTCGTTC
GCCTCGCAGGCCGGAAGACGTCACGGCCATTCCTCCTCCGACAAGGCCTCGCCCTCGCGCTCCTCCCGTCACCCT
TCCTCTCCTTCCCGATCGCATCGCAGCACTCAGAGCTCCTCGGCTTCACCGCCTCCCCGCTACATTCCCGCCCAT
CTGCAGGACGAAGTCCTCGCCTCCAAATCCCAGTCCACCGCTCGTTCCCCTACCCCGGACTCCGCTGGAAGTGTC
CTCGACTATCCCGCGGCCGCCTGCGCTGGTCTGACCCTCCACAGCGACCCTGCGACCGATATGTCCGGCTCTGAC
GACAAGGGAGACTCGAACCTCCCGCTTGCCGGGTCCGATGCTCGCGAAACCTCCGCCTCGGAGAATGAGGTGAAC
GATGTGGAGATGGACTTGGTTCCGACAGAAAAGGACAGCCAGACCCGTTCCGACCACCCGGATTCGATGGAAACC
ACGACATCGGGCGATGACAACGTAACCAACTCGGCGTCGGACAGTGTGTATCCCACTCCTTCCAGCATGTCCACC
TATACCGCCCCCACAGAGACCCGGGCCCATTCTAAAGCAGAGGCCGGGGTTGCGTCAGCTGATCGACCATCTTAC
GATGACCAGGTCGCACAGGTGACCCAGTTTATGATGCAGCCGATGAAGGAGAAACAAAAGGGATATGTGGTGTCG
AATTCGTGGCTGAAGCGAGTGTACTCGCGGAGTGCTACTCATGCAGACAAGGCTGATAAGACGGCGATGGAGGGA
GATATCGGACCAGTCGATAACTCGGATATTGTTCTGGTCACCGACCCGGCCAACACTGGTTTCAAGGACGAGGAA
GGAGAACCCTTTGTTCCTTTGAGGCCTGGCTTGGAGCTTGGCGAAGATTTTGAGATTATCCCTCAAGGGGGCTGG
GACCTGATCATGCAGTGGTATGGTCTGGCAGAACAGTCCCCGGCCATCGTCCGTTACGTTCACAACACCGCCGCC
GTAGGCGACCAGGAGAACCTCCAATACGAGATCAACCCTCCGATCTTCACGATCTTGAAGCTCACGAACCCCTCT
GCCGGCACTTCTATCAAGACGATGAAGGAGAAGACGATGGCCCCAGTGAGGACACTGGCCAGTCGACACACCAAC
TTCCAGAAGTGGCTGAAGAACGCCAAAGAACTCGCTCAAATCGACATGTCGACGAAGGTTCGTGTTTGGAGGATT
CTGGGTGGTCTCGGTAGCGCCACCGCATCGGCAGCAGCCACCCCAGCTGCATCCCGCAGTGCTTCTCCAGCTCCG
TCCGCCTCCCTCATCGCCAACGCTGGAAGCAACCTCGTTCTCGACCTGAACACCTTCCTTTCCCTGTCGGAGGGG
TCGCAGCGTGAGGTACTTGACGAGCCGAAGGACCAGACGAACAATCCCAACTACAATGGTAAAATGACTCTGGGC
GTTGCGGGTCTCAACAGCAGCGAAATCATCGTGCTGGAAGAGAAGCTCCCTGGAACGAGCGGAGAATGGGTATCG
GAAGCCTCCAAGCAGACACTTAACCGTCTGGGGGTGCCGTCCGGTAGCCTAAAGAACGGAGCTCCCGCAAAGGTG
AAGACCAAGAGTCCTGCTACCAGCGGGCGATCGTCTCCGGTCTCAGAACCCATCAGGGGTCGACGCAAGGACGGG
AAACCCCGCGGCTGCACTGGTTTGAGCAATCTTGGAAACACTTGTTACATGAACTCGGCCCTGCAGTGCGTTCGC
AGTGTCGAGGAATTAACCTACTATTTCTTGAATGACGTTTACAAGAAGGACCTCAACCCCAGCAATCCTCTAGCT
CATAATGGTGATGTGGCTAAAGCATACGCGAATATGTTGCGTCAGATGTATGATGAGGCAGGACAATCTTCGTTT
GCGCCCCGTCAGCTGAAGCACACCATCGGCCGCTATGGACCGGCCTTCTCCGGTTACGGACAGCAGGATTCCCAG
GAATTCCTTCTCTTCCTTCTGGATGGTCTTCAGGAGGATCTGAACCGTATTATGAAGAAGCCCTACATTGAAAAG
CCGGACTCGACGGACGAGATGGTGCATAACAAGGAAGCTCTCGCAGAGTTTGCGGACAAGTGCTGGGATATCTAC
AAAGCCCGTAACGACTCCGTCATTACCGACCTCTTTGCTGGTATGTACAAGTCGACGCTGGTCTGCCCTGCTTGC
GACAAGGTCAGCATCATTTTCGACCCTTTCAACAACCTGACCCTTCAGCTTCCGATCGAGAATCTCTGGGGTAAA
GAGATTTTCTACTTCCCTCTCAACAAGAAGCCGGTCCTTGTCGATGTCGAAATCGACAAGAACGCCAGTGTCAAG
GCGCTGAAGGAGCAGGTCGCAAAGAAAATGGGAACCGACCCTGAGCGCCTCGTGATGGCTGAGATCTACAAGAAC
AAGTTCTACAAGATGTTCGACAACACGAGCTCGATTGCGGAGTGCCAGATCAGCGGCAACGACGACATTGGTATC
TACGAAGTCGAGTCAGTACCTACGAACTACAACCCCGACAAGCCCCAGAAGAGCTACTTCTCCTTCAGTCGCTCG
GATCATGAGGAGATCCCCAGTTTGGACTCGCCTCGATCTGACCGCTTGCTCGTCCCCATCTTTAACCGAGTCGAG
AAGAAACGGGGAAACAACCCCAAGAATGCGCAACGGTCGCTCTTCGGAGTTCCATCGTATGTGGTCATCAATCGG
GAGGAGTTTGGGGACTACGATACGATCTTCCGCAAGGTCCTGTCGCAGGTCGCCTCGATGTCCACCCGTGACTTC
CTGAATGAGGAGAATACGACCGAGGTCAGCCATGAAGACTCAGACACCGTTATTATGAACGAGGATGATGCGGAG
TCGGCTGACTCGAAGATCAAGACTGCGTCCGTTGACGGCGAGGACGGCATGGTCGATGTCTCGATGCGTGACGCG
GATGACAGTTCAAGCGACGCCCCAGCCCGCTCCGAAAGTGCTATTTCCCCTAATTTGCGCGGTCTTTTCGAGATG
AAGATCATCAAGTCGAGTAGCGAGGTTGTTCCCACTGGGTGGTCAACCGTGGATGACCACAAGGAGTATCCGAAG
ATGTCATTTAGAATCAAGACGCCGGTGAAGAAGCAGAAACAGTCCGTGGACAGCACGAATGGCACGGAGCAGAAG
GATGAAGAGTCCGGAGATAAGAGCTCCGACAGTGCCAGTGGTGAATCGGCTTCTAAGCCTAAGGCTCAGGACCGG
CCGATGATCCGCCCCGGTGAGGGTATTGTAGTGGACTGGACTGAGCAAGCTCATGACGCTCTCTTCGCTGGAAGC
AGTAGAGACAAGAACTCCCTGCGTGGGGCGCCGACATGGACGGACGTCGAACGCGTGCCTGACCCGGAACTGAGC
AAGCGCCGTACTCTGCGCCAAAACCGGAAGAAGCGGGGCGTGACGCTCTACGAGTGTCTGGACGAGTTCAACAAA
GAGGAGGTCCTTTCCGAGAACGATGCTTGGTACTGTCCCCGCTGCAAGGAGCACCGTCGGGCCAGCAAGAAGTTC
GAGTTGTGGAAGACACCGGACATTCTGGTCATGCACCTCAAGAGGTTCAGCGCCAGCCGCGGATTCCGCGACAAG
CTGGATGTCCTGGTCGACTTCCCAGTGGAGGGCCTCGATATGACCGGCAGGGTCGAGGCGCCTGAAGAGGGCAAG
AGTCAGATCTACGACCTCTTCGCCGTCGACAATCACTACGGAGGCCTTGGTGGCGGACACTACACAGCGTACGCC
AAGAACTTTTTCACCGGGCAGTGGAACGAATATAACGATTCTTCCGTCTCGCGCCCGATTGATCCGCAGAGTGTG
GTCACCTCGTCGGCGTATCTGCTGTTTTACCGGCGCCGGTCCGACCGGCCGCTGGGCGGCAAGGTGTTGGAGGAG
ATCACGGAAGCGTCGACACGGCCGAACAGCGACGTGGACTCGCAGACCGAGTCTCGCGGACAGTCTCCGTCGGGG
GAAGGCCGGCGCCTCGGCGGCTCCTCCCGCAATGGGTCGTCGAGCGCCTTAACCGGAGTCGGAGCAGCTCACCAA
TCGGGAGATGGTGGTTTGCCAACTGGAACCCAAACGAAGAGCGGGGATGATGACTGGCCGCCGGGATATACCAAC
GTCCCATCATTTGGCGAGCAGAGCCTAGATCGCGCGACGCAATCGGAAGGTATGAATTTCGAAGATGAGGAGATT
GGCGGGGGCATGCAGCCCAGCCCGTTCCGCCCTCAGGACGACACACCCTCGTGGTCGTTCAGTCGCGCCACAGAT
GCTCACGGCCCTTCACAGATGACCACAGTTCCAACTGACGACGAAGATCTACTCGACGATGACGCGAGCAACCAG
GCCGTAGGCGGCGGCGATGTCAGCGACCCGGACCTTCGGATGGCCTCTTTGATGGACAGTCCACGCGGGGCCGCC
TACCCAGGTACCCCGATGGAGGAGACGTCATTCCCGGACATTTCGGCATTTGCAGCGGACGGTGACGATGACGAG
GAGGATGAGTTGCCGGTGGTAGAACTCCAAGTGCATGATGAAGACCAGACACTGCCGTAG
Transcript >Ani_SJS72_1|g2057.t1
ATGTCGATTGATCTTGTGTTACTCGCGGCGAATGTGAGGATTTGCCTTGCAGACCAGGAAGGGGTGCCAAGTCGC
GATTGGTTGTTGACGGCATTGTCCGACTGGCAACCGGGATATCTCATCAACAAAGTGTCATACACTGAGTGCATT
GTCTCTCTTGTGACCGTTTGTCAAAGTGAAATGAACGGACTGACTAAACGTTTTCGTTCCTTTTGCATCGCTACT
CTTCTAGTGTCGAGCTCAGTTTCCAACCCATCTACCGTGCTACCTCGAGCTGCCACGAAACGTGCGCAGCTCACC
GTCACGACGTCTTCCACAAAGCGCCGTAAAGTAGCAGAGCCTCGCAGACCAGGATCGCTTCCGGGTTTGTCGTTC
GCCTCGCAGGCCGGAAGACGTCACGGCCATTCCTCCTCCGACAAGGCCTCGCCCTCGCGCTCCTCCCGTCACCCT
TCCTCTCCTTCCCGATCGCATCGCAGCACTCAGAGCTCCTCGGCTTCACCGCCTCCCCGCTACATTCCCGCCCAT
CTGCAGGACGAAGTCCTCGCCTCCAAATCCCAGTCCACCGCTCGTTCCCCTACCCCGGACTCCGCTGGAAGTGTC
CTCGACTATCCCGCGGCCGCCTGCGCTGGTCTGACCCTCCACAGCGACCCTGCGACCGATATGTCCGGCTCTGAC
GACAAGGGAGACTCGAACCTCCCGCTTGCCGGGTCCGATGCTCGCGAAACCTCCGCCTCGGAGAATGAGGTGAAC
GATGTGGAGATGGACTTGGTTCCGACAGAAAAGGACAGCCAGACCCGTTCCGACCACCCGGATTCGATGGAAACC
ACGACATCGGGCGATGACAACGTAACCAACTCGGCGTCGGACAGTGTGTATCCCACTCCTTCCAGCATGTCCACC
TATACCGCCCCCACAGAGACCCGGGCCCATTCTAAAGCAGAGGCCGGGGTTGCGTCAGCTGATCGACCATCTTAC
GATGACCAGGTCGCACAGGTGACCCAGTTTATGATGCAGCCGATGAAGGAGAAACAAAAGGGATATGTGGTGTCG
AATTCGTGGCTGAAGCGAGTGTACTCGCGGAGTGCTACTCATGCAGACAAGGCTGATAAGACGGCGATGGAGGGA
GATATCGGACCAGTCGATAACTCGGATATTGTTCTGGTCACCGACCCGGCCAACACTGGTTTCAAGGACGAGGAA
GGAGAACCCTTTGTTCCTTTGAGGCCTGGCTTGGAGCTTGGCGAAGATTTTGAGATTATCCCTCAAGGGGGCTGG
GACCTGATCATGCAGTGGTATGGTCTGGCAGAACAGTCCCCGGCCATCGTCCGTTACGTTCACAACACCGCCGCC
GTAGGCGACCAGGAGAACCTCCAATACGAGATCAACCCTCCGATCTTCACGATCTTGAAGCTCACGAACCCCTCT
GCCGGCACTTCTATCAAGACGATGAAGGAGAAGACGATGGCCCCAGTGAGGACACTGGCCAGTCGACACACCAAC
TTCCAGAAGTGGCTGAAGAACGCCAAAGAACTCGCTCAAATCGACATGTCGACGAAGGTTCGTGTTTGGAGGATT
CTGGGTGGTCTCGGTAGCGCCACCGCATCGGCAGCAGCCACCCCAGCTGCATCCCGCAGTGCTTCTCCAGCTCCG
TCCGCCTCCCTCATCGCCAACGCTGGAAGCAACCTCGTTCTCGACCTGAACACCTTCCTTTCCCTGTCGGAGGGG
TCGCAGCGTGAGGTACTTGACGAGCCGAAGGACCAGACGAACAATCCCAACTACAATGGTAAAATGACTCTGGGC
GTTGCGGGTCTCAACAGCAGCGAAATCATCGTGCTGGAAGAGAAGCTCCCTGGAACGAGCGGAGAATGGGTATCG
GAAGCCTCCAAGCAGACACTTAACCGTCTGGGGGTGCCGTCCGGTAGCCTAAAGAACGGAGCTCCCGCAAAGGTG
AAGACCAAGAGTCCTGCTACCAGCGGGCGATCGTCTCCGGTCTCAGAACCCATCAGGGGTCGACGCAAGGACGGG
AAACCCCGCGGCTGCACTGGTTTGAGCAATCTTGGAAACACTTGTTACATGAACTCGGCCCTGCAGTGCGTTCGC
AGTGTCGAGGAATTAACCTACTATTTCTTGAATGACGTTTACAAGAAGGACCTCAACCCCAGCAATCCTCTAGCT
CATAATGGTGATGTGGCTAAAGCATACGCGAATATGTTGCGTCAGATGTATGATGAGGCAGGACAATCTTCGTTT
GCGCCCCGTCAGCTGAAGCACACCATCGGCCGCTATGGACCGGCCTTCTCCGGTTACGGACAGCAGGATTCCCAG
GAATTCCTTCTCTTCCTTCTGGATGGTCTTCAGGAGGATCTGAACCGTATTATGAAGAAGCCCTACATTGAAAAG
CCGGACTCGACGGACGAGATGGTGCATAACAAGGAAGCTCTCGCAGAGTTTGCGGACAAGTGCTGGGATATCTAC
AAAGCCCGTAACGACTCCGTCATTACCGACCTCTTTGCTGGTATGTACAAGTCGACGCTGGTCTGCCCTGCTTGC
GACAAGGTCAGCATCATTTTCGACCCTTTCAACAACCTGACCCTTCAGCTTCCGATCGAGAATCTCTGGGGTAAA
GAGATTTTCTACTTCCCTCTCAACAAGAAGCCGGTCCTTGTCGATGTCGAAATCGACAAGAACGCCAGTGTCAAG
GCGCTGAAGGAGCAGGTCGCAAAGAAAATGGGAACCGACCCTGAGCGCCTCGTGATGGCTGAGATCTACAAGAAC
AAGTTCTACAAGATGTTCGACAACACGAGCTCGATTGCGGAGTGCCAGATCAGCGGCAACGACGACATTGGTATC
TACGAAGTCGAGTCAGTACCTACGAACTACAACCCCGACAAGCCCCAGAAGAGCTACTTCTCCTTCAGTCGCTCG
GATCATGAGGAGATCCCCAGTTTGGACTCGCCTCGATCTGACCGCTTGCTCGTCCCCATCTTTAACCGAGTCGAG
AAGAAACGGGGAAACAACCCCAAGAATGCGCAACGGTCGCTCTTCGGAGTTCCATCGTATGTGGTCATCAATCGG
GAGGAGTTTGGGGACTACGATACGATCTTCCGCAAGGTCCTGTCGCAGGTCGCCTCGATGTCCACCCGTGACTTC
CTGAATGAGGAGAATACGACCGAGGTCAGCCATGAAGACTCAGACACCGTTATTATGAACGAGGATGATGCGGAG
TCGGCTGACTCGAAGATCAAGACTGCGTCCGTTGACGGCGAGGACGGCATGGTCGATGTCTCGATGCGTGACGCG
GATGACAGTTCAAGCGACGCCCCAGCCCGCTCCGAAAGTGCTATTTCCCCTAATTTGCGCGGTCTTTTCGAGATG
AAGATCATCAAGTCGAGTAGCGAGGTTGTTCCCACTGGGTGGTCAACCGTGGATGACCACAAGGAGTATCCGAAG
ATGTCATTTAGAATCAAGACGCCGGTGAAGAAGCAGAAACAGTCCGTGGACAGCACGAATGGCACGGAGCAGAAG
GATGAAGAGTCCGGAGATAAGAGCTCCGACAGTGCCAGTGGTGAATCGGCTTCTAAGCCTAAGGCTCAGGACCGG
CCGATGATCCGCCCCGGTGAGGGTATTGTAGTGGACTGGACTGAGCAAGCTCATGACGCTCTCTTCGCTGGAAGC
AGTAGAGACAAGAACTCCCTGCGTGGGGCGCCGACATGGACGGACGTCGAACGCGTGCCTGACCCGGAACTGAGC
AAGCGCCGTACTCTGCGCCAAAACCGGAAGAAGCGGGGCGTGACGCTCTACGAGTGTCTGGACGAGTTCAACAAA
GAGGAGGTCCTTTCCGAGAACGATGCTTGGTACTGTCCCCGCTGCAAGGAGCACCGTCGGGCCAGCAAGAAGTTC
GAGTTGTGGAAGACACCGGACATTCTGGTCATGCACCTCAAGAGGTTCAGCGCCAGCCGCGGATTCCGCGACAAG
CTGGATGTCCTGGTCGACTTCCCAGTGGAGGGCCTCGATATGACCGGCAGGGTCGAGGCGCCTGAAGAGGGCAAG
AGTCAGATCTACGACCTCTTCGCCGTCGACAATCACTACGGAGGCCTTGGTGGCGGACACTACACAGCGTACGCC
AAGAACTTTTTCACCGGGCAGTGGAACGAATATAACGATTCTTCCGTCTCGCGCCCGATTGATCCGCAGAGTGTG
GTCACCTCGTCGGCGTATCTGCTGTTTTACCGGCGCCGGTCCGACCGGCCGCTGGGCGGCAAGGTGTTGGAGGAG
ATCACGGAAGCGTCGACACGGCCGAACAGCGACGTGGACTCGCAGACCGAGTCTCGCGGACAGTCTCCGTCGGGG
GAAGGCCGGCGCCTCGGCGGCTCCTCCCGCAATGGGTCGTCGAGCGCCTTAACCGGAGTCGGAGCAGCTCACCAA
TCGGGAGATGGTGGTTTGCCAACTGGAACCCAAACGAAGAGCGGGGATGATGACTGGCCGCCGGGATATACCAAC
GTCCCATCATTTGGCGAGCAGAGCCTAGATCGCGCGACGCAATCGGAAGGTATGAATTTCGAAGATGAGGAGATT
GGCGGGGGCATGCAGCCCAGCCCGTTCCGCCCTCAGGACGACACACCCTCGTGGTCGTTCAGTCGCGCCACAGAT
GCTCACGGCCCTTCACAGATGACCACAGTTCCAACTGACGACGAAGATCTACTCGACGATGACGCGAGCAACCAG
GCCGTAGGCGGCGGCGATGTCAGCGACCCGGACCTTCGGATGGCCTCTTTGATGGACAGTCCACGCGGGGCCGCC
TACCCAGGTACCCCGATGGAGGAGACGTCATTCCCGGACATTTCGGCATTTGCAGCGGACGGTGACGATGACGAG
GAGGATGAGTTGCCGGTGGTAGAACTCCAAGTGCATGATGAAGACCAGACACTGCCGTAG
Gene >Ani_SJS72_1|g2057.t1
ATGTCGATTGATCTTGTGTTACTCGCGGCGAATGTGAGGATTTGCCTTGCAGACCAGGAAGGGGTGCCAAGTCGC
GATTGGTTGTTGACGGCATTGTCCGACTGGCAACCGGGATATCTCATCAACAAAGTGTCATACACTGAGTGCATT
GTCTCTCTTGTGACCGTTTGTCAAAGTGAAAGTAAACTATGACACCTTTGTTGTCTTTGACAAGAGGTTTATCTC
ACTTATACTTGATGGAGTTTCCGAAGAAGGAAGAGGCTATTGCCCTGCCATACGCGCCATATGCTGCAGGCGTTC
ACATATGGTTTGAACGGGCCAGTATATCAATACAACGGCACCGCTGCATAATGAACAGGGAATCGGTCACTTTAA
TTGATCTATGAATGCGTGCTGACCGCCTAGTCGTGCATTGAATCGCAAATATGGGGAATGTGTTATCGAAGTGGC
TCGCACCCCAGCCAGCAGGGGAAAGTGAGAAAAGGGCCGGGTTGGGGCCTCCAGAAACAGCCACGCCGCCCAGCC
CAGAGCAGACGCCGATCCGCATCGACCCTCCCCAAATGTTGTTAGCATCACCCACAGAAAAAAGTAAGTCGTCTT
GCTTCTCTTTTAGTTGTTGATTGCCTGTCAAGTTTGGATTTATTTTTTTGAGGGTTGCTCCATGCTCTCTTGTTT
CTCCATCGATCCTTAAGTTCCTTTTAATTTTTTTTTTCACATCCACTTCCCAACCCCACCAATCCCGAAACTTGA
CCAAACCTGTCAACGCGCGCCCGGGTAAAATCCCTGGTTGAAAAAAAAATCGCGAACAGACAGGATAGTCAGTCA
ATCAGACAAGAGGGAGGGAGAGAATTGAACACTTGCTTTCCCGCCGGCAAAGAATCTGGCCAAGCGGAAGTTCTT
TTCCAACCCAATCCCATTCCATCCAATCCAATCCAATCCACCTCTCCCCTCTTCGAACTAAAAAATCTACTGTGT
ACTCACACTGCTACACCCGCAAAGTGAACGGACTGACTAAACGTTTTCGTTCCTTTTGCATCGCTACTCTTCTAG
GTTCTTCCCTCCACATCCTCCCATCCTCTTCCTCCACCCACCCCCCCGGTCTGACCAACACCAATCCAGTGTCGA
GCTCAGTTTCCAACCCATCTACCGTGCTACCTCGAGCTGCCACGAAACGTGCGCAGCTCACCGTCACGACGTCTT
CCACAAAGCGCCGTAAAGTAGCAGAGCCTCGCAGACCAGGATCGCTTCCGGGTTTGTCGTTCGCCTCGCAGGCCG
GAAGACGTCACGGCCATTCCTCCTCCGACAAGGCCTCGCCCTCGCGCTCCTCCCGTCACCCTTCCTCTCCTTCCC
GATCGCATCGCAGCACTCAGAGCTCCTCGGCTTCACCGCCTCCCCGCTACATTCCCGCCCATCTGCAGGACGAAG
TCCTCGCCTCCAAATCCCAGTCCACCGCTCGTTCCCCTACCCCGGACTCCGCTGGAAGTGTCCTCGACTATCCCG
CGGCCGCCTGCGCTGGTCTGACCCTCCACAGCGACCCTGCGACCGATATGTCCGGCTCTGACGACAAGGGAGACT
CGAACCTCCCGCTTGCCGGGTCCGATGCTCGCGAAACCTCCGCCTCGGAGAATGAGGTGAACGATGTGGAGATGG
ACTTGGTTCCGACAGAAAAGGACAGCCAGACCCGTTCCGACCACCCGGATTCGATGGAAACCACGACATCGGGCG
ATGACAACGTAACCAACTCGGCGTCGGACAGTGTGTATCCCACTCCTTCCAGCATGTCCACCTATACCGCCCCCA
CAGAGACCCGGGCCCATTCTAAAGCAGAGGCCGGGGTTGCGTCAGCTGATCGACCATCTTACGATGACCAGGTCG
CACAGGTGACCCAGTTTATGATGCAGCCGATGAAGGAGAAACAAAAGGGATATGTGGTGTCGAATTCGTGGCTGA
AGCGAGTGTACTCGCGGAGTGCTACTCATGCAGACAAGGCTGATAAGACGGCGATGGAGGGAGATATCGGACCAG
TCGATAACTCGGATATTGTTCTGGTCACCGACCCGGCCAACACTGGTTTCAAGGACGAGGAAGGAGAACCCTTTG
TTCCTTTGAGGCCTGGCTTGGAGCTTGGCGAAGATTTTGAGATTATCCCTCAAGGGGGCTGGGACCTGATCATGC
AGTGGTATGGTCTGGCAGAACAGTCCCCGGCCATCGTCCGTTACGTTCACAACACCGCCGCCGTAGGCGACCAGG
AGAACCTCCAATACGAGATCAACCCTCCGATCTTCACGATCTTGAAGCTCACGAACCCCTCTGCCGGCACTTCTA
TCAAGACGATGAAGGAGAAGACGATGGCCCCAGTGAGGACACTGGCCAGTCGACACACCAACTTCCAGAAGTGGC
TGAAGAACGCCAAAGAACTCGCTCAAATCGACATGTCGACGAAGGTTCGTGTTTGGAGGATTCTGGGTGGTCTCG
GTAGCGCCACCGCATCGGCAGCAGCCACCCCAGCTGCATCCCGCAGTGCTTCTCCAGCTCCGTCCGCCTCCCTCA
TCGCCAACGCTGGAAGCAACCTCGTTCTCGACCTGAACACCTTCCTTTCCCTGTCGGAGGGGTCGCAGCGTGAGG
TACTTGACGAGCCGAAGGACCAGACGAACAATCCCAACTACAATGGTAAAATGACTCTGGGCGTTGCGGGTCTCA
ACAGCAGCGAAATCATCGTGCTGGAAGAGAAGCTCCCTGGAACGAGCGGAGAATGGGTATCGGAAGCCTCCAAGC
AGACACTTAACCGTCTGGGGGTGCCGTCCGGTAGCCTAAAGAACGGAGCTCCCGCAAAGGTGAAGACCAAGAGTC
CTGCTACCAGCGGGCGATCGTCTCCGGTCTCAGAACCCATCAGGGGTCGACGCAAGGACGGGAAACCCCGCGGCT
GCACTGGTTTGAGCAATCTTGGAAACACTTGTTACATGAACTCGGCCCTGCAGTGCGTTCGCAGTGTCGAGGAAT
TAACCTACTATTTCTTGAGTGCGTCAGACCTCCGCCCTAAGAAAATGTACTCCGCTAATTATCTATCTAGATGAC
GTTTACAAGAAGGACCTCAACCCCAGCAATCCTCTAGCTCATAATGGTGATGTGGCTAAAGCATACGCGAATATG
TTGCGTCAGATGTATGATGAGGCAGGACAATCTTCGTTTGCGCCCCGTCAGCTGAAGCACACCATCGGCCGCTAT
GGACCGGCCTTCTCCGGTTACGGACAGCAGGATTCCCAGGAATTCCTTCTCTTCCTTCTGGATGGTCTTCAGGAG
GATCTGAACCGTATTATGAAGAAGCCCTACATTGAAAAGCCGGACTCGACGGACGAGATGGTGCATAACAAGGAA
GCTCTCGCAGAGTTTGCGGACAAGTGCTGGGATATCTACAAAGCCCGTAACGACTCCGTCATTACCGACCTCTTT
GCTGGTATGTACAAGTCGACGCTGGTCTGCCCTGCTTGCGACAAGGTCAGCATCATTTTCGACCCTTTCAACAAC
CTGACCCTTCAGCTTCCGATCGAGAATCTCTGGGGTAAAGAGATTTTCTACTTCCCTCTCAACAAGAAGCCGGTC
CTTGTCGATGTCGAAATCGACAAGAACGCCAGTGTCAAGGCGCTGAAGGAGCAGGTCGCAAAGAAAATGGGAACC
GACCCTGAGCGCCTCGTGATGGCTGAGATCTACAAGAACAAGTTCTACAAGATGTTCGACAACACGAGCTCGATT
GCGGAGTGCCAGATCAGCGGCAACGACGACATTGGTATCTACGAAGTCGAGTCAGTACCTACGAACTACAACCCC
GACAAGCCCCAGAAGAGCTACTTCTCCTTCAGTCGCTCGGATCATGAGGAGATCCCCAGTTTGGACTCGCCTCGA
TCTGACCGCTTGCTCGTCCCCATCTTTAACCGAGTCGAGAAGAAACGGGGAAACAACCCCAAGAATGCGCAACGG
TCGCTCTTCGGAGTTCCATCGTATGTGGTCATCAATCGGGAGGAGTTTGGGGACTACGATACGATCTTCCGCAAG
GTCCTGTCGCAGGTCGCCTCGATGTCCACCCGTGACTTCCTGAATGAGGAGAATACGACCGAGGTCAGCCATGAA
GACTCAGACACCGTTATTATGAACGAGGATGATGCGGAGTCGGCTGACTCGAAGATCAAGACTGCGTCCGTTGAC
GGCGAGGACGGCATGGTCGATGTCTCGATGCGTGACGCGGATGACAGTTCAAGCGACGCCCCAGCCCGCTCCGAA
AGTGCTATTTCCCCTAATTTGCGCGGTCTTTTCGAGATGAAGATCATCAAGTCGAGTAGCGAGGTTGTTCCCACT
GGGTGGTCAACCGTGGATGACCACAAGGAGTATCCGAAGATGTCATTTAGAATCAAGACGCCGGTGAAGAAGCAG
AAACAGGTAAGTCGTTCTCTTTGTTTTCATTTGGAACTTCCACTAAACGATGGTCAGTCCGTGGACAGCACGAAT
GGCACGGAGCAGAAGGATGAAGAGTCCGGAGATAAGAGCTCCGACAGTGCCAGTGGTGAATCGGCTTCTAAGCCT
AAGGCTCAGGACCGGCCGATGATCCGCCCCGGTGAGGGTATTGTAGTGGACTGGACTGAGCAAGCTCATGACGCT
CTCTTCGCTGGAAGCAGTAGAGACAAGAACTCCCTGCGTGGGGCGCCGACATGGACGGACGTCGAACGCGTGCCT
GACCCGGAACTGAGCAAGCGCCGTACTCTGCGCCAAAACCGGAAGAAGCGGGGCGTGACGCTCTACGAGTGTCTG
GACGAGTTCAACAAAGAGGAGGTCCTTTCCGAGAACGATGCTTGGTACTGTCCCCGCTGCAAGGAGCACCGTCGG
GCCAGCAAGAAGTTCGAGTTGTGGAAGACACCGGACATTCTGGTCATGCACCTCAAGAGGTTCAGCGCCAGCCGC
GGATTCCGCGACAAGCTGGATGTCCTGGTCGACTTCCCAGTGGAGGGCCTCGATATGACCGGCAGGGTCGAGGCG
CCTGAAGAGGGCAAGAGTCAGATCTACGACCTCTTCGCCGTCGACAATCACTACGGAGGCCTTGGTGGCGGACAC
TACACAGCGTACGCCAAGAACTTTTTCACCGGGCAGTGGAACGAATATAACGGTAAGATCGCCTGAATCATAGAC
GTTTTGGACAACAACTGACTGGACTAGATTCTTCCGTCTCGCGCCCGATTGATCCGCAGAGTGTGGTCACCTCGT
CGGCGTATCTGCTGTTTTACCGGCGCCGGTCCGACCGGCCGCTGGGCGGCAAGGTGTTGGAGGAGATCACGGAAG
CGTCGACACGGCCGAACAGCGACGTGGACTCGCAGACCGAGTCTCGCGGACAGTCTCCGTCGGGGGAAGGCCGGC
GCCTCGGCGGCTCCTCCCGCAATGGGTCGTCGAGCGCCTTAACCGGAGTCGGAGCAGCTCACCAATCGGGAGATG
GTGGTTTGCCAACTGGAACCCAAACGAAGAGCGGGGATGATGACTGGCCGCCGGGATATACCAACGTCCCATCAT
TTGGCGAGCAGAGCCTAGATCGCGCGACGCAATCGGAAGGTATGAATTTCGAAGATGAGGAGATTGGCGGGGGCA
TGCAGCCCAGCCCGTTCCGCCCTCAGGACGACACACCCTCGTGGTCGTTCAGTCGCGCCACAGATGCTCACGGCC
CTTCACAGATGACCACAGTTCCAACTGACGACGAAGATCTACTCGACGATGACGCGAGCAACCAGGCCGTAGGCG
GCGGCGATGTCAGCGACCCGGACCTTCGGATGGCCTCTTTGATGGACAGTCCACGCGGGGCCGCCTACCCAGGTA
CCCCGATGGAGGAGACGTCATTCCCGGACATTTCGGCATTTGCAGCGGACGGTGACGATGACGAGGAGGATGAGT
TGCCGGTGGTAGAACTCCAAGTGCATGATGAAGACCAGACACTGCCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail