Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g1898.t1
Gene name
Locationscaffold_009:95500..96311
Strand+
Gene length (bp)811
Transcript length (bp)738
Coding sequence length (bp)738
Protein length (aa) 246

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00535 Glycos_transf_2 Glycosyl transferase family 2 7.3E-35 9 183
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 1.6E-13 7 219

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT2_Glycos_transf_2 3.8E-36 9 183

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup9058
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g2473.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g8355.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g2110.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g1275.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g5477.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g1342.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g3703.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g4124.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g1220.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g1633.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g3095.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g3955.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g2471.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g5647.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g1223.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g1898.t1 (this protein)
Aspergillus niger CBS 147346 Ani_SJS75_1|g4956.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g4199.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g4347.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g8913.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g5382.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g3291.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g3369.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g5837.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g1898.t1
MGAAENKYSVILPTYNERKNLPIIVWLLERTFRENNLNWEIIIVDDGSPDGTLDIARQLQKHYGSNHILLHPRAG
KLGLGTAYIHGLQFTTGNYVIIMDADFSHHPKFIPEMIRIQKLGDADIVTGTRYASRDGIKGGVYGWDLFRKFTS
RTANLIADVMLMPGVSDLTGSFRLYKKSVLEKVIHSTQSKGYSFQMEMMVRAKAMGFRVAECPITFVDRLYGESK
LGGHEIVEYLKGVVNLWLKV*
Coding >Ani_SJS72_1|g1898.t1
ATGGGCGCCGCCGAAAACAAATACTCGGTCATCCTGCCGACCTACAACGAGCGCAAGAACCTCCCTATCATCGTC
TGGCTCCTGGAGCGGACCTTTCGCGAGAACAACCTAAACTGGGAAATCATCATCGTTGACGACGGCAGCCCGGAC
GGCACTCTGGACATCGCGCGCCAACTCCAAAAGCACTACGGCAGCAACCACATCCTGCTCCACCCCCGAGCGGGC
AAACTCGGCCTGGGAACGGCGTACATCCACGGCCTTCAATTCACAACAGGCAACTACGTCATCATCATGGACGCG
GACTTCAGCCACCACCCGAAATTCATCCCGGAGATGATTCGCATCCAGAAGCTAGGGGACGCAGACATCGTGACG
GGCACACGGTACGCCAGTCGCGATGGCATTAAGGGTGGTGTGTACGGATGGGACCTGTTCAGGAAGTTTACCTCC
CGCACGGCGAATCTCATTGCGGATGTGATGTTGATGCCTGGGGTGAGTGATCTTACGGGAAGCTTTCGCTTGTAT
AAGAAGAGTGTGCTGGAGAAGGTCATTCATAGTACACAGAGTAAGGGGTATAGTTTTCAGATGGAGATGATGGTT
CGGGCTAAGGCCATGGGGTTCAGGGTTGCGGAGTGTCCGATTACGTTTGTGGATCGGTTGTATGGGGAGAGTAAG
TTGGGCGGTCATGAGATTGTGGAGTATTTGAAGGGGGTAGTGAATCTTTGGTTGAAGGTTTGA
Transcript >Ani_SJS72_1|g1898.t1
ATGGGCGCCGCCGAAAACAAATACTCGGTCATCCTGCCGACCTACAACGAGCGCAAGAACCTCCCTATCATCGTC
TGGCTCCTGGAGCGGACCTTTCGCGAGAACAACCTAAACTGGGAAATCATCATCGTTGACGACGGCAGCCCGGAC
GGCACTCTGGACATCGCGCGCCAACTCCAAAAGCACTACGGCAGCAACCACATCCTGCTCCACCCCCGAGCGGGC
AAACTCGGCCTGGGAACGGCGTACATCCACGGCCTTCAATTCACAACAGGCAACTACGTCATCATCATGGACGCG
GACTTCAGCCACCACCCGAAATTCATCCCGGAGATGATTCGCATCCAGAAGCTAGGGGACGCAGACATCGTGACG
GGCACACGGTACGCCAGTCGCGATGGCATTAAGGGTGGTGTGTACGGATGGGACCTGTTCAGGAAGTTTACCTCC
CGCACGGCGAATCTCATTGCGGATGTGATGTTGATGCCTGGGGTGAGTGATCTTACGGGAAGCTTTCGCTTGTAT
AAGAAGAGTGTGCTGGAGAAGGTCATTCATAGTACACAGAGTAAGGGGTATAGTTTTCAGATGGAGATGATGGTT
CGGGCTAAGGCCATGGGGTTCAGGGTTGCGGAGTGTCCGATTACGTTTGTGGATCGGTTGTATGGGGAGAGTAAG
TTGGGCGGTCATGAGATTGTGGAGTATTTGAAGGGGGTAGTGAATCTTTGGTTGAAGGTTTGA
Gene >Ani_SJS72_1|g1898.t1
ATGGGCGCCGCCGAAAACAAATACTCGGTCATCCTGCCGACCTACAACGAGCGCAAGAACCTCCCTATCATCGTC
TGGCTCCTGGAGCGGACCTTTCGCGAGAAGTACACACACCTCTCCATCACCTCCCTCCCCCCATCCCCCCAATCC
CATTACTAACGAAAAGACAAACGATAGCAACCTAAACTGGGAAATCATCATCGTTGACGACGGCAGCCCGGACGG
CACTCTGGACATCGCGCGCCAACTCCAAAAGCACTACGGCAGCAACCACATCCTGCTCCACCCCCGAGCGGGCAA
ACTCGGCCTGGGAACGGCGTACATCCACGGCCTTCAATTCACAACAGGCAACTACGTCATCATCATGGACGCGGA
CTTCAGCCACCACCCGAAATTCATCCCGGAGATGATTCGCATCCAGAAGCTAGGGGACGCAGACATCGTGACGGG
CACACGGTACGCCAGTCGCGATGGCATTAAGGGTGGTGTGTACGGATGGGACCTGTTCAGGAAGTTTACCTCCCG
CACGGCGAATCTCATTGCGGATGTGATGTTGATGCCTGGGGTGAGTGATCTTACGGGAAGCTTTCGCTTGTATAA
GAAGAGTGTGCTGGAGAAGGTCATTCATAGTACACAGAGTAAGGGGTATAGTTTTCAGATGGAGATGATGGTTCG
GGCTAAGGCCATGGGGTTCAGGGTTGCGGAGTGTCCGATTACGTTTGTGGATCGGTTGTATGGGGAGAGTAAGTT
GGGCGGTCATGAGATTGTGGAGTATTTGAAGGGGGTAGTGAATCTTTGGTTGAAGGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail