Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g1785.t1
Gene name
Locationscaffold_008:307403..312120
Strand+
Gene length (bp)4717
Transcript length (bp)4488
Coding sequence length (bp)4488
Protein length (aa) 1496

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18404 Glyco_transf_24 Glucosyltransferase 24 9.6E-150 1188 1454
PF18402 Thioredoxin_14 Thioredoxin-like domain 8.5E-68 411 655
PF18400 Thioredoxin_12 Thioredoxin-like domain 4.3E-54 42 225
PF18403 Thioredoxin_15 Thioredoxin-like domain 4.9E-51 667 865
PF18401 Thioredoxin_13 Thioredoxin-like domain 8.9E-43 275 402
PF06427 UDP-g_GGTase UDP-glucose:Glycoprotein Glucosyltransferase 8.7E-43 1038 1147

GO

GO Term Description Terminal node
GO:0006486 protein glycosylation Yes
GO:0003980 UDP-glucose:glycoprotein glucosyltransferase activity Yes
GO:0008150 biological_process No
GO:0035251 UDP-glucosyltransferase activity No
GO:0008152 metabolic process No
GO:0043412 macromolecule modification No
GO:0046527 glucosyltransferase activity No
GO:0016758 hexosyltransferase activity No
GO:0043413 macromolecule glycosylation No
GO:0019538 protein metabolic process No
GO:0003674 molecular_function No
GO:0016757 glycosyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0044238 primary metabolic process No
GO:0070085 glycosylation No
GO:0043170 macromolecule metabolic process No
GO:0008194 UDP-glycosyltransferase activity No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g1785.t1
MVSGLANFASWRLASVLIAGLLAIQGRASPSVNVALQASFDSPPYLIELLESAAEENSTSYFPLLDRIADGIFDD
AVTDKDLYDRFLEVVREDGHLRTPESLSSFKLSLAMRSASPRITAHYQYYNASVQYSLMAAQDAVCPVWVHSEGK
QYCSSTMERAQQDVTGSDDPRELPFDRVFGDPSLPPAILYADIASPMFKEFHQSLSTMAKEGQVSYRVRYRPPQH
WSPRPVFVSGYGVELALKRTDYIVIDDRDAEERGTGSIESGKSDETEDDLDDLRPLSSSEVSRLGLNTVGYVLDS
DDPFDTLVKLSQDFPKYSARVAAHNVSTELLQDVRSSRLRMLPPGLNVLWINGVQIEPRQVDAFTLLDHLRRERK
LIEKFRNLGLSATDAVELLSHPLLGEALARDGPQRYNYRDDIEGGGVIMWLNNLEKDARYESWPSELAGFMQRTY
PGQLPAVRRDSNNIVFPVDLTSTEDADIVVKTIQVFVKNKIPVRFGLIPVTFSDGAIAQLKVAHYLQETFGLASF
MDYLEASASKNKLASPDKACFQAATQDRSPRLEKVSLSLDEVLNNAVYDATVSKTTAYLNRLGMKHEPSHAFVNG
IPVTRNDKWAQEMSTKISKDTQLIQQKIADAEVDEDTWLPELFLSQAFDRRNPAIVPEDPKEIRAVDLVQLADSQ
EKLFSQIPRLGLDESNALESAHAIVVGNFDEKSGYELLSAALESRKTHGEVEMLFLHNPKLEASPASRSVAVRRL
LNGGKEVDASQILEAIASSASPADEEAGDAALFWEAQRAVVEELGLAPGERALVINGRVVGPIAEDTALTSEDLD
QLLIYEKQKRITPVAKAVKALEFDEKLSDPLDFAKLTSLTTLSTISDVPEGIYESTSDIRLNLFNRWNDSQSAIT
VSNSDDPAITIVASIDPTSEVAQKWLPILKVLSELASVRVRLVLNPREEIKELPTKRFYRYVLDSEPSFNEDGSV
SRPTASFSGVPVEALLTLGMDVPSSWLVAPKDSIHDLDNIKLSSVKDGSNVDAIYALEHILIEGHSRDMTTKSPP
RGVQLVLGTENNPHFSDTIIMANLGYFQFKAQPGLWNINLKPGRSERIFTLDSVGSLGYNPQPGDENNEVALLSF
QGRTLFPRVSRKKGYETEDVLETNPKPGSAMDYMNKGFNFASGILSSVGVGTKGSTSGKQADINIFSVASGHLYE
RMLNIMMVSVMRNTNHSVKFWFIEQFLSPSFKSFLPHLAKEYNFSYEMVTYKWPHWLRAQKEKQREIWGYKILFL
DVLFPLDLDKVIFVDADQIVRTDMYDLVSLDLEGAPYGFTPMCDSRHEMEGFRFWKQGYWKNFLRGQPYHISALY
VVDLNRFRAIAAGDRLRGQYQMLSADPESLSNLDQDLPNHMQHHIPIKSLPQEWLWCETWCSDESQSQARTIDLC
NNPMTKEPKLDRARRQVPEWTEYDDEIAALSKRVAAEKQQGQVEEERAGESYPDEDEEGETSSGWDKDEL*
Coding >Ani_SJS72_1|g1785.t1
ATGGTATCTGGACTGGCAAATTTCGCCTCATGGCGACTTGCATCTGTATTGATTGCCGGCCTGCTGGCTATCCAG
GGACGCGCTAGTCCATCAGTCAATGTTGCTCTCCAAGCTTCGTTTGATTCCCCACCTTATCTGATAGAGCTACTC
GAATCCGCTGCGGAGGAGAACTCCACCTCATACTTCCCGTTACTCGATCGGATCGCCGACGGTATTTTCGATGAC
GCTGTTACGGATAAGGACCTATATGATCGCTTCCTGGAGGTTGTGCGTGAGGATGGACACTTACGGACCCCTGAA
AGTCTCTCATCTTTCAAGCTGTCGCTGGCGATGAGATCCGCCAGTCCGCGGATCACGGCTCACTACCAGTACTAC
AATGCTTCGGTTCAATATTCGTTAATGGCCGCGCAGGATGCGGTCTGTCCTGTTTGGGTGCACTCCGAAGGAAAG
CAATACTGCTCGTCTACTATGGAACGCGCCCAGCAGGATGTTACGGGTTCTGATGACCCACGAGAACTCCCTTTC
GATCGTGTCTTCGGAGATCCCTCTCTGCCTCCAGCGATTTTGTATGCGGATATAGCGTCCCCGATGTTCAAGGAA
TTTCACCAGTCACTGAGTACGATGGCGAAAGAAGGACAAGTCTCGTATCGCGTGCGATACAGACCTCCTCAACAT
TGGTCTCCACGTCCTGTTTTTGTGTCTGGATACGGTGTCGAGCTGGCGTTAAAGCGGACGGACTATATTGTGATT
GATGATAGAGACGCGGAAGAAAGAGGGACCGGCAGCATTGAGTCCGGAAAGTCTGATGAGACAGAAGATGATTTG
GATGACCTGAGACCCCTGTCATCATCCGAAGTTTCTCGGCTTGGGCTGAACACGGTCGGGTATGTGTTGGATAGC
GATGACCCGTTTGACACACTTGTGAAGCTGTCACAGGATTTCCCCAAATACTCCGCACGTGTTGCGGCTCACAAC
GTTTCCACCGAGCTGTTGCAAGATGTTCGGTCCAGCAGATTGCGTATGCTTCCGCCGGGGCTCAACGTGCTCTGG
ATCAACGGTGTTCAGATTGAACCTCGACAAGTGGACGCATTCACTCTTCTGGATCACTTGCGTCGCGAAAGGAAA
TTGATCGAGAAGTTCCGAAACTTAGGCCTGTCCGCTACAGATGCTGTAGAGCTTTTGTCACACCCTCTGCTTGGA
GAGGCCTTGGCACGGGATGGCCCTCAGCGTTACAACTACCGTGATGACATTGAGGGAGGTGGTGTCATCATGTGG
CTGAACAATCTCGAAAAGGATGCGCGCTATGAATCGTGGCCTAGCGAACTCGCAGGATTTATGCAACGCACATAT
CCAGGCCAGCTTCCGGCAGTCCGCCGCGATTCCAACAATATTGTCTTTCCTGTCGACTTGACGAGCACTGAAGAT
GCTGATATTGTTGTCAAGACAATCCAGGTCTTTGTGAAGAACAAAATTCCCGTCAGATTTGGTTTGATTCCGGTC
ACATTCTCAGACGGAGCAATTGCTCAGCTCAAGGTCGCTCATTACCTTCAAGAGACTTTTGGTCTGGCCAGTTTT
ATGGATTACCTTGAAGCGTCGGCGTCCAAAAATAAGTTGGCTTCTCCGGATAAGGCCTGCTTCCAGGCTGCAACT
CAGGACCGGAGTCCTCGTCTGGAGAAGGTGTCTCTATCTCTAGATGAAGTCTTGAATAATGCTGTATATGACGCA
ACGGTATCAAAGACAACTGCGTACCTAAACCGTCTGGGGATGAAGCACGAGCCATCACATGCTTTTGTTAACGGC
ATTCCTGTCACCCGCAATGACAAATGGGCGCAGGAAATGAGCACAAAAATAAGCAAAGATACTCAGCTAATTCAG
CAGAAGATTGCTGATGCCGAGGTCGATGAAGATACCTGGTTGCCAGAATTGTTTCTCTCGCAGGCTTTCGATAGG
CGCAATCCGGCGATCGTTCCAGAGGACCCGAAAGAGATCCGGGCTGTGGACTTGGTGCAGCTTGCGGACTCCCAA
GAGAAGCTCTTCAGTCAGATTCCACGTTTAGGGCTAGATGAAAGCAATGCCTTGGAGAGTGCCCATGCCATCGTT
GTTGGCAACTTTGATGAGAAATCCGGTTACGAGCTACTCAGCGCGGCCCTTGAGAGCCGAAAAACACATGGTGAA
GTTGAGATGCTTTTCCTACACAATCCTAAGCTCGAGGCGTCCCCCGCATCTAGGTCTGTCGCTGTTCGTCGATTG
TTGAATGGTGGCAAAGAGGTAGATGCCAGCCAGATTTTGGAGGCGATCGCCTCTTCCGCCTCGCCAGCAGATGAG
GAAGCTGGGGATGCGGCACTCTTCTGGGAGGCTCAGCGAGCTGTAGTAGAAGAGCTTGGACTCGCTCCGGGCGAA
AGGGCACTTGTCATCAACGGAAGGGTCGTTGGACCGATTGCAGAAGACACCGCCCTGACCTCAGAGGACCTGGAC
CAGCTACTGATATATGAGAAGCAAAAGCGGATTACTCCGGTAGCAAAGGCGGTCAAAGCCCTTGAATTCGACGAG
AAGCTTTCTGATCCGCTAGACTTTGCCAAGCTTACCTCGCTCACCACGCTGTCCACGATCTCGGATGTGCCAGAG
GGCATATATGAGTCGACTTCGGACATTCGGTTGAATTTGTTCAACAGATGGAACGACTCACAATCAGCTATCACT
GTCTCCAATTCCGATGATCCAGCAATTACCATTGTAGCATCTATCGATCCGACTTCGGAAGTTGCTCAGAAGTGG
CTACCAATTCTAAAAGTACTGTCGGAGCTGGCAAGTGTCAGAGTGAGATTGGTCCTGAACCCGCGCGAGGAGATC
AAAGAGCTGCCCACCAAGCGCTTCTATCGTTATGTTCTCGATTCGGAGCCATCGTTCAACGAAGATGGGTCGGTT
TCCCGGCCCACAGCCTCCTTCTCGGGCGTTCCCGTCGAGGCACTCCTCACCCTGGGCATGGATGTTCCCTCTTCT
TGGCTTGTGGCTCCCAAGGATTCTATCCACGATCTTGACAATATCAAGTTAAGTTCCGTCAAGGACGGCTCGAAT
GTCGATGCTATTTACGCATTGGAACACATCTTGATCGAGGGCCACTCCCGGGATATGACCACGAAGTCCCCACCT
AGAGGAGTTCAGCTTGTCCTTGGAACTGAGAACAACCCTCACTTCTCGGATACAATCATCATGGCCAATCTCGGA
TACTTCCAATTCAAAGCCCAACCTGGACTGTGGAACATCAACCTCAAACCGGGCCGTAGCGAACGCATCTTCACC
CTCGACAGCGTAGGCAGCCTCGGCTACAACCCCCAACCTGGCGACGAAAACAACGAAGTGGCCCTCCTCTCCTTC
CAAGGCCGCACCCTTTTCCCGCGTGTCTCCCGTAAGAAGGGCTACGAGACCGAAGACGTCCTCGAGACCAACCCC
AAACCAGGTTCTGCGATGGACTACATGAATAAGGGGTTCAACTTCGCCTCCGGTATCCTCTCCAGCGTCGGAGTC
GGCACCAAAGGCAGCACTAGCGGCAAACAGGCTGACATTAACATCTTCTCCGTCGCCAGTGGACACCTCTACGAG
CGCATGCTCAACATTATGATGGTCTCAGTGATGCGCAACACCAACCACAGCGTGAAATTCTGGTTCATCGAACAA
TTCCTCTCCCCGTCCTTCAAGTCCTTCCTGCCTCACCTTGCGAAGGAGTATAACTTCTCTTACGAAATGGTCACC
TACAAATGGCCACACTGGCTCCGGGCCCAGAAAGAAAAGCAACGTGAAATCTGGGGCTACAAGATCCTCTTCCTG
GACGTTCTCTTCCCTCTCGACCTCGACAAAGTCATCTTTGTCGACGCCGACCAGATAGTCCGCACAGATATGTAC
GACCTCGTCAGCCTTGACCTCGAAGGCGCTCCGTACGGCTTTACTCCCATGTGCGACTCCCGCCACGAGATGGAA
GGCTTCCGCTTCTGGAAGCAGGGGTACTGGAAGAACTTCCTCCGTGGTCAACCCTACCATATCTCCGCGCTTTAC
GTTGTCGACCTGAACCGCTTCCGTGCCATCGCCGCCGGCGATCGCCTGCGTGGACAGTACCAGATGCTGTCAGCT
GACCCCGAGAGTTTGAGCAACCTGGACCAGGATCTGCCGAACCACATGCAGCATCATATCCCGATCAAGAGTCTG
CCGCAGGAGTGGCTGTGGTGTGAGACTTGGTGCTCGGATGAGTCGCAGTCACAGGCTCGGACGATCGACCTGTGC
AATAACCCGATGACGAAGGAGCCGAAGTTGGATCGTGCCAGGAGGCAGGTACCTGAGTGGACGGAGTATGATGAT
GAGATTGCGGCCTTGTCGAAGAGAGTTGCCGCTGAGAAGCAGCAGGGGCAGGTGGAGGAAGAAAGGGCCGGTGAA
TCGTACCCTGACGAGGATGAGGAGGGCGAGACTTCCTCTGGCTGGGATAAGGATGAGCTTTAG
Transcript >Ani_SJS72_1|g1785.t1
ATGGTATCTGGACTGGCAAATTTCGCCTCATGGCGACTTGCATCTGTATTGATTGCCGGCCTGCTGGCTATCCAG
GGACGCGCTAGTCCATCAGTCAATGTTGCTCTCCAAGCTTCGTTTGATTCCCCACCTTATCTGATAGAGCTACTC
GAATCCGCTGCGGAGGAGAACTCCACCTCATACTTCCCGTTACTCGATCGGATCGCCGACGGTATTTTCGATGAC
GCTGTTACGGATAAGGACCTATATGATCGCTTCCTGGAGGTTGTGCGTGAGGATGGACACTTACGGACCCCTGAA
AGTCTCTCATCTTTCAAGCTGTCGCTGGCGATGAGATCCGCCAGTCCGCGGATCACGGCTCACTACCAGTACTAC
AATGCTTCGGTTCAATATTCGTTAATGGCCGCGCAGGATGCGGTCTGTCCTGTTTGGGTGCACTCCGAAGGAAAG
CAATACTGCTCGTCTACTATGGAACGCGCCCAGCAGGATGTTACGGGTTCTGATGACCCACGAGAACTCCCTTTC
GATCGTGTCTTCGGAGATCCCTCTCTGCCTCCAGCGATTTTGTATGCGGATATAGCGTCCCCGATGTTCAAGGAA
TTTCACCAGTCACTGAGTACGATGGCGAAAGAAGGACAAGTCTCGTATCGCGTGCGATACAGACCTCCTCAACAT
TGGTCTCCACGTCCTGTTTTTGTGTCTGGATACGGTGTCGAGCTGGCGTTAAAGCGGACGGACTATATTGTGATT
GATGATAGAGACGCGGAAGAAAGAGGGACCGGCAGCATTGAGTCCGGAAAGTCTGATGAGACAGAAGATGATTTG
GATGACCTGAGACCCCTGTCATCATCCGAAGTTTCTCGGCTTGGGCTGAACACGGTCGGGTATGTGTTGGATAGC
GATGACCCGTTTGACACACTTGTGAAGCTGTCACAGGATTTCCCCAAATACTCCGCACGTGTTGCGGCTCACAAC
GTTTCCACCGAGCTGTTGCAAGATGTTCGGTCCAGCAGATTGCGTATGCTTCCGCCGGGGCTCAACGTGCTCTGG
ATCAACGGTGTTCAGATTGAACCTCGACAAGTGGACGCATTCACTCTTCTGGATCACTTGCGTCGCGAAAGGAAA
TTGATCGAGAAGTTCCGAAACTTAGGCCTGTCCGCTACAGATGCTGTAGAGCTTTTGTCACACCCTCTGCTTGGA
GAGGCCTTGGCACGGGATGGCCCTCAGCGTTACAACTACCGTGATGACATTGAGGGAGGTGGTGTCATCATGTGG
CTGAACAATCTCGAAAAGGATGCGCGCTATGAATCGTGGCCTAGCGAACTCGCAGGATTTATGCAACGCACATAT
CCAGGCCAGCTTCCGGCAGTCCGCCGCGATTCCAACAATATTGTCTTTCCTGTCGACTTGACGAGCACTGAAGAT
GCTGATATTGTTGTCAAGACAATCCAGGTCTTTGTGAAGAACAAAATTCCCGTCAGATTTGGTTTGATTCCGGTC
ACATTCTCAGACGGAGCAATTGCTCAGCTCAAGGTCGCTCATTACCTTCAAGAGACTTTTGGTCTGGCCAGTTTT
ATGGATTACCTTGAAGCGTCGGCGTCCAAAAATAAGTTGGCTTCTCCGGATAAGGCCTGCTTCCAGGCTGCAACT
CAGGACCGGAGTCCTCGTCTGGAGAAGGTGTCTCTATCTCTAGATGAAGTCTTGAATAATGCTGTATATGACGCA
ACGGTATCAAAGACAACTGCGTACCTAAACCGTCTGGGGATGAAGCACGAGCCATCACATGCTTTTGTTAACGGC
ATTCCTGTCACCCGCAATGACAAATGGGCGCAGGAAATGAGCACAAAAATAAGCAAAGATACTCAGCTAATTCAG
CAGAAGATTGCTGATGCCGAGGTCGATGAAGATACCTGGTTGCCAGAATTGTTTCTCTCGCAGGCTTTCGATAGG
CGCAATCCGGCGATCGTTCCAGAGGACCCGAAAGAGATCCGGGCTGTGGACTTGGTGCAGCTTGCGGACTCCCAA
GAGAAGCTCTTCAGTCAGATTCCACGTTTAGGGCTAGATGAAAGCAATGCCTTGGAGAGTGCCCATGCCATCGTT
GTTGGCAACTTTGATGAGAAATCCGGTTACGAGCTACTCAGCGCGGCCCTTGAGAGCCGAAAAACACATGGTGAA
GTTGAGATGCTTTTCCTACACAATCCTAAGCTCGAGGCGTCCCCCGCATCTAGGTCTGTCGCTGTTCGTCGATTG
TTGAATGGTGGCAAAGAGGTAGATGCCAGCCAGATTTTGGAGGCGATCGCCTCTTCCGCCTCGCCAGCAGATGAG
GAAGCTGGGGATGCGGCACTCTTCTGGGAGGCTCAGCGAGCTGTAGTAGAAGAGCTTGGACTCGCTCCGGGCGAA
AGGGCACTTGTCATCAACGGAAGGGTCGTTGGACCGATTGCAGAAGACACCGCCCTGACCTCAGAGGACCTGGAC
CAGCTACTGATATATGAGAAGCAAAAGCGGATTACTCCGGTAGCAAAGGCGGTCAAAGCCCTTGAATTCGACGAG
AAGCTTTCTGATCCGCTAGACTTTGCCAAGCTTACCTCGCTCACCACGCTGTCCACGATCTCGGATGTGCCAGAG
GGCATATATGAGTCGACTTCGGACATTCGGTTGAATTTGTTCAACAGATGGAACGACTCACAATCAGCTATCACT
GTCTCCAATTCCGATGATCCAGCAATTACCATTGTAGCATCTATCGATCCGACTTCGGAAGTTGCTCAGAAGTGG
CTACCAATTCTAAAAGTACTGTCGGAGCTGGCAAGTGTCAGAGTGAGATTGGTCCTGAACCCGCGCGAGGAGATC
AAAGAGCTGCCCACCAAGCGCTTCTATCGTTATGTTCTCGATTCGGAGCCATCGTTCAACGAAGATGGGTCGGTT
TCCCGGCCCACAGCCTCCTTCTCGGGCGTTCCCGTCGAGGCACTCCTCACCCTGGGCATGGATGTTCCCTCTTCT
TGGCTTGTGGCTCCCAAGGATTCTATCCACGATCTTGACAATATCAAGTTAAGTTCCGTCAAGGACGGCTCGAAT
GTCGATGCTATTTACGCATTGGAACACATCTTGATCGAGGGCCACTCCCGGGATATGACCACGAAGTCCCCACCT
AGAGGAGTTCAGCTTGTCCTTGGAACTGAGAACAACCCTCACTTCTCGGATACAATCATCATGGCCAATCTCGGA
TACTTCCAATTCAAAGCCCAACCTGGACTGTGGAACATCAACCTCAAACCGGGCCGTAGCGAACGCATCTTCACC
CTCGACAGCGTAGGCAGCCTCGGCTACAACCCCCAACCTGGCGACGAAAACAACGAAGTGGCCCTCCTCTCCTTC
CAAGGCCGCACCCTTTTCCCGCGTGTCTCCCGTAAGAAGGGCTACGAGACCGAAGACGTCCTCGAGACCAACCCC
AAACCAGGTTCTGCGATGGACTACATGAATAAGGGGTTCAACTTCGCCTCCGGTATCCTCTCCAGCGTCGGAGTC
GGCACCAAAGGCAGCACTAGCGGCAAACAGGCTGACATTAACATCTTCTCCGTCGCCAGTGGACACCTCTACGAG
CGCATGCTCAACATTATGATGGTCTCAGTGATGCGCAACACCAACCACAGCGTGAAATTCTGGTTCATCGAACAA
TTCCTCTCCCCGTCCTTCAAGTCCTTCCTGCCTCACCTTGCGAAGGAGTATAACTTCTCTTACGAAATGGTCACC
TACAAATGGCCACACTGGCTCCGGGCCCAGAAAGAAAAGCAACGTGAAATCTGGGGCTACAAGATCCTCTTCCTG
GACGTTCTCTTCCCTCTCGACCTCGACAAAGTCATCTTTGTCGACGCCGACCAGATAGTCCGCACAGATATGTAC
GACCTCGTCAGCCTTGACCTCGAAGGCGCTCCGTACGGCTTTACTCCCATGTGCGACTCCCGCCACGAGATGGAA
GGCTTCCGCTTCTGGAAGCAGGGGTACTGGAAGAACTTCCTCCGTGGTCAACCCTACCATATCTCCGCGCTTTAC
GTTGTCGACCTGAACCGCTTCCGTGCCATCGCCGCCGGCGATCGCCTGCGTGGACAGTACCAGATGCTGTCAGCT
GACCCCGAGAGTTTGAGCAACCTGGACCAGGATCTGCCGAACCACATGCAGCATCATATCCCGATCAAGAGTCTG
CCGCAGGAGTGGCTGTGGTGTGAGACTTGGTGCTCGGATGAGTCGCAGTCACAGGCTCGGACGATCGACCTGTGC
AATAACCCGATGACGAAGGAGCCGAAGTTGGATCGTGCCAGGAGGCAGGTACCTGAGTGGACGGAGTATGATGAT
GAGATTGCGGCCTTGTCGAAGAGAGTTGCCGCTGAGAAGCAGCAGGGGCAGGTGGAGGAAGAAAGGGCCGGTGAA
TCGTACCCTGACGAGGATGAGGAGGGCGAGACTTCCTCTGGCTGGGATAAGGATGAGCTTTAG
Gene >Ani_SJS72_1|g1785.t1
ATGGTATCTGGACTGGCAAATTTCGCCTCATGGCGACTTGCATCTGTATTGATTGCCGGCCTGCTGGCTATCCAG
GGACGCGCTAGTCCATCAGTCAATGTTGCTCTCCAAGCTTCGTTTGATTCCCCACCTTATCTGATAGAGCTACTG
TAAGTGAAATTCAGACAGATCTAGTTGGATGCTCTTGATTCCTGGGCTGACCTCTATGTAGCGAATCCGCTGCGG
AGGAGAACTCCACCTCATACTTCCCGTTACTCGATCGGATCGCCGACGGTATTTTCGATGACGCTGTTACGGATA
AGGACCTATATGATCGCTTCCTGGAGGTTGTGCGTGAGGATGGACACTTACGGACCCCTGAAAGTCTCTCATCTT
TCAAGCTGTCGCTGGCGATGAGATCCGCCAGTCCGCGGATCACGGCTCACTACCAGTACTACAATGCTTCGGTTC
AATATTCGTTAATGGCCGCGCAGGATGCGGTCTGTCCTGTTTGGGTGCACTCCGAAGGAAAGCAATACTGCTCGT
CTACTATGGAACGCGCCCAGCAGGATGTTACGGGTTCTGAGTGAGTGGTAATCTCAAATTTGTGTCTACATGCTG
GTGACTAACCGCTACAATGTAGTGACCCACGAGAACTCCCTTTCGATCGTGTCTTCGGAGATCCCTCTCTGCCTC
CAGCGATTTTGTATGCGGATATAGCGTCCCCGATGTTCAAGGAATTTCACCAGTCACTGAGTACGATGGCGAAAG
AAGGACAAGTCTCGTATCGCGTGCGATACAGACCTCCTCAACATTGGTCTCCACGTCCTGTTTTTGTGTCTGGAT
ACGGTGTCGAGCTGGCGTTAAAGCGGACGGACTATATTGTGATTGATGATAGAGACGCGGAAGAAAGAGGGACCG
GCAGCATTGAGTCCGGAAAGTCTGATGAGACAGAAGATGATTTGGATGACCTGAGACCCCTGTCATCATCCGAAG
TTTCTCGGCTTGGGCTGAACACGGTCGGGTATGTGTTGGATAGCGATGACCCGTTTGACACACTTGTGAAGCTGT
CACAGGATTTCCCCAAATACTCCGCACGTGTTGCGGCTCACAACGTTTCCACCGAGCTGTTGCAAGATGTTCGGT
CCAGCAGATTGCGTATGCTTCCGCCGGGGCTCAACGTGCTCTGGATCAACGGTGTTCAGATTGAACCTCGACAAG
TGGACGCATTCACTCTTCTGGATCACTTGCGTCGCGAAAGGAAATTGATCGAGAAGTTCCGAAACTTAGGCCTGT
CCGCTACAGATGCTGTAGAGCTTTTGTCACACCCTCTGCTTGGAGAGGCCTTGGCACGGGATGGCCCTCAGCGTT
ACAACTACCGTGATGACATTGAGGGAGGTGGTGTCATCATGTGGCTGAACAATCTCGAAAAGGATGCGCGCTATG
AATCGTGGCCTAGCGAACTCGCAGGAGTAGGTACATCCGGGATTCTTTATTGCGGAGATGCTAATGTCTGGTAGT
TTATGCAACGCACATATCCAGGCCAGCTTCCGGCAGTCCGCCGCGATTCCAACAATATTGTCTTTCCTGTCGACT
TGACGAGCACTGAAGATGCTGATATTGTTGTCAAGACAATCCAGGTCTTTGTGAAGAACAAAATTCCCGTCAGAT
TTGGTTTGATTCCGGTCACATTCTCAGACGGAGCAATTGCTCAGCTCAAGGTCGCTCATTACCTTCAAGAGACTT
TTGGTCTGGCCAGTTTTATGGATTACCTTGAAGCGGTAAGGACTAACTTTCCCGTAACCAAATTCCGCTATTGTT
TGTCAGTTACTAATTGGAGCAGTCGGCGTCCAAAAATAAGTTGGCTTCTCCGGATAAGGCCTGCTTCCAGGCTGC
AACTCAGGACCGGAGTCCTCGTCTGGAGAAGGTGTCTCTATCTCTAGATGAAGTCTTGAATAATGCTGTATATGA
CGCAACGGTATCAAAGACAACTGCGTACCTAAACCGTCTGGGGATGAAGCACGAGCCATCACATGCTTTTGTTAA
CGGCATTCCTGTCACCCGCAATGACAAATGGGCGCAGGAAATGAGCACAAAAATAAGCAAAGATACTCAGCTAAT
TCAGCAGAAGATTGCTGATGCCGAGGTCGATGAAGATACCTGGTTGCCAGAATTGTTTCTCTCGCAGGCTTTCGA
TAGGCGCAATCCGGCGATCGTTCCAGAGGACCCGAAAGAGATCCGGGCTGTGGACTTGGTGCAGCTTGCGGACTC
CCAAGAGAAGCTCTTCAGTCAGATTCCACGTTTAGGGCTAGATGAAAGCAATGCCTTGGAGAGTGCCCATGCCAT
CGTTGTTGGCAACTTTGATGAGAAATCCGGTTACGAGCTACTCAGCGCGGCCCTTGAGAGCCGAAAAACACATGG
TGAAGTTGAGATGCTTTTCCTACACAATCCTAAGCTCGAGGCGTCCCCCGCATCTAGGTCTGTCGCTGTTCGTCG
ATTGTTGAATGGTGGCAAAGAGGTAGATGCCAGCCAGATTTTGGAGGCGATCGCCTCTTCCGCCTCGCCAGCAGA
TGAGGAAGCTGGGGATGCGGCACTCTTCTGGGAGGCTCAGCGAGCTGTAGTAGAAGAGCTTGGACTCGCTCCGGG
CGAAAGGGCACTTGTCATCAACGGAAGGGTCGTTGGACCGATTGCAGAAGACACCGCCCTGACCTCAGAGGACCT
GGACCAGCTACTGATATATGAGAAGCAAAAGCGGATTACTCCGGTAGCAAAGGCGGTCAAAGCCCTTGAATTCGA
CGAGAAGCTTTCTGATCCGCTAGACTTTGCCAAGCTTACCTCGCTCACCACGCTGTCCACGATCTCGGATGTGCC
AGAGGGCATATATGAGTCGACTTCGGACATTCGGTTGAATTTGTTCAACAGATGGAACGACTCACAATCAGCTAT
CACTGTCTCCAATTCCGATGATCCAGCAATTACCATTGTAGCATCTATCGATCCGACTTCGGAAGTTGCTCAGAA
GTGGCTACCAATTCTAAAAGTACTGTCGGAGCTGGCAAGTGTCAGAGTGAGATTGGTCCTGAACCCGCGCGAGGA
GATCAAAGAGCTGCCCACCAAGCGCTTCTATCGTTATGTTCTCGATTCGGAGCCATCGTTCAACGAAGATGGGTC
GGTTTCCCGGCCCACAGCCTCCTTCTCGGGCGTTCCCGTCGAGGCACTCCTCACCCTGGGCATGGATGTTCCCTC
TTCTTGGCTTGTGGCTCCCAAGGATTCTATCCACGATCTTGACAATATCAAGTTAAGTTCCGTCAAGGACGGCTC
GAATGTCGATGCTATTTACGCATTGGAACACATCTTGATCGAGGGCCACTCCCGGGATATGACCACGAAGTCCCC
ACCTAGAGGAGTTCAGCTTGTCCTTGGAACTGAGAACAACCCTCACTTCTCGGATACAATCATCATGGCCAATCT
CGGATACTTCCAATTCAAAGCCCAACCTGGACTGTGGAACATCAACCTCAAACCGGGCCGTAGCGAACGCATCTT
CACCCTCGACAGCGTAGGCAGCCTCGGCTACAACCCCCAACCTGGCGACGAAAACAACGAAGTGGCCCTCCTCTC
CTTCCAAGGCCGCACCCTTTTCCCGCGTGTCTCCCGTAAGAAGGGCTACGAGACCGAAGACGTCCTCGAGACCAA
CCCCAAACCAGGTTCTGCGATGGACTACATGAATAAGGGGTTCAACTTCGCCTCCGGTATCCTCTCCAGCGTCGG
AGTCGGCACCAAAGGCAGCACTAGCGGCAAACAGGCTGACATTAACATCTTCTCCGTCGCCAGTGGACACCTCTA
CGAGCGCATGCTCAACATTATGATGGTCTCAGTGATGCGCAACACCAACCACAGCGTGAAATTCTGGTTCATCGA
ACAATTCCTCTCCCCGTCCTTCAAGTCCTTCCTGCCTCACCTTGCGAAGGAGTATAACTTCTCTTACGAAATGGT
CACCTACAAATGGCCACACTGGCTCCGGGCCCAGAAAGAAAAGCAACGTGAAATCTGGGGCTACAAGATCCTCTT
CCTGGACGTTCTCTTCCCTCTCGACCTCGACAAAGTCATCTTTGTCGACGCCGACCAGATAGTCCGCACAGATAT
GTACGACCTCGTCAGCCTTGACCTCGAAGGCGCTCCGTACGGCTTTACTCCCATGTGCGACTCCCGCCACGAGAT
GGAAGGCTTCCGCTTCTGGAAGCAGGGGTACTGGAAGAACTTCCTCCGTGGTCAACCCTACCATATCTCCGCGCT
TTACGTTGTCGACCTGAACCGCTTCCGTGCCATCGCCGCCGGCGATCGCCTGCGTGGACAGTACCAGATGCTGTC
AGCTGACCCCGAGAGTTTGAGCAACCTGGACCAGGATCTGCCGAACCACATGCAGCATCATATCCCGATCAAGAG
TCTGCCGCAGGAGTGGCTGTGGTGTGAGACTTGGTGCTCGGATGAGTCGCAGTCACAGGCTCGGACGATCGACCT
GTGCAATAACCCGATGACGAAGGAGCCGAAGTTGGATCGTGCCAGGAGGCAGGTACCTGAGTGGACGGAGTATGA
TGATGAGATTGCGGCCTTGTCGAAGAGAGTTGCCGCTGAGAAGCAGCAGGGGCAGGTGGAGGAAGAAAGGGCCGG
TGAATCGTACCCTGACGAGGATGAGGAGGGCGAGACTTCCTCTGGCTGGGATAAGGATGAGCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail