Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g1762.t1
Gene name
Locationscaffold_008:248154..250757
Strand+
Gene length (bp)2603
Transcript length (bp)2172
Coding sequence length (bp)2172
Protein length (aa) 724

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13243 SQHop_cyclase_C Squalene-hopene cyclase C-terminal domain 8.2E-53 374 701
PF13249 SQHop_cyclase_N Squalene-hopene cyclase N-terminal domain 5.3E-37 73 322
PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat 7.6E-01 74 91
PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat 1.8E-05 110 152
PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat 3.3E+00 474 486
PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat 3.2E-10 544 580
PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat 4.0E-10 592 641

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g1762.t1
MPMTASTTDPTRWRLIVDEGVHQWRYVSEADSARRVQSTAEKYFLGLPTGLPSLEIPHSFQQSARNGFRFYQKLQ
LDDGHWGCGYGGPSFLLAGIVIAMYITETDIPSEWKAELLRYLSNTVNEDGGWGLHAAGASTVFATTLYYVTLRI
LGVQPSHPLTSKARVRLHALGGAVGIPQWGKIWLALLNLYSWGGINPIPPELWLLPDWIPFHPWRWWVQCRVVYL
PVSYLYANKVAIPLNPLIASLRQEIYTQSYESIHFEKHRDAVAVTDLKKPPSSLLRVANMCLHFWEQYFRPNYVA
QWANERVYELIRREDENTSYNCLAPVNKAFHMVSVWHSDGATSTRMHRHREVIPSYMWVGEEGMTCSGTNGVQVW
DTAFSIQAMVEAGVSMLPEFRSTLEKALKYLDISQLREDLADEYRQPRKGGWPFSTRNNGYIVSDCAAEALKAVL
MLQEECHFIKLISDDRLQDCVDSLLLMQNPDGGFSSYERTRSSTLLEHLNASEVFDRIMVEYSYPECTTAVVTAL
SLFKQYFPSYRAKEINGVIERAVKYVIKAQRPDGSWYGSWGVCFTYASFFAMQCLELVDQTWQNSSHVRKCCKFL
LSKQKEDGGWGEHYTSCEQEECVNHERSQVVNTAWACLALMHARYPYKEDIEKGLKLIMSRQQRNGEWYQEDVEG
VFNNTCMIGYPNYKLYFTSWALGRYVHMYLPMLKREGYEYITALDIKF*
Coding >Ani_SJS72_1|g1762.t1
ATGCCAATGACTGCATCGACGACAGATCCCACGAGATGGCGTCTCATTGTGGATGAGGGTGTTCACCAATGGCGG
TATGTTAGCGAAGCCGACTCAGCACGTCGAGTACAGTCCACAGCAGAGAAATACTTTCTTGGATTGCCCACGGGA
TTGCCGTCACTCGAAATCCCACACAGCTTTCAGCAATCTGCTCGCAATGGTTTCCGTTTTTATCAAAAACTCCAG
CTGGATGATGGCCACTGGGGATGTGGTTATGGTGGCCCCAGCTTCTTACTTGCTGGTATTGTAATAGCGATGTAC
ATCACTGAGACGGACATTCCCTCTGAATGGAAGGCCGAGCTTCTCCGTTATCTTTCAAACACGGTCAATGAAGAT
GGTGGCTGGGGGCTACATGCTGCTGGTGCCTCCACCGTTTTCGCAACAACTCTCTATTATGTCACCTTGCGAATT
CTAGGGGTCCAGCCGAGTCATCCTCTCACTAGTAAGGCGCGTGTCCGCCTACACGCCCTAGGTGGGGCAGTCGGG
ATCCCGCAGTGGGGTAAGATCTGGCTGGCTCTGTTGAATCTTTACAGCTGGGGTGGAATCAATCCCATCCCCCCA
GAGCTGTGGTTGCTCCCCGATTGGATCCCATTCCATCCATGGCGTTGGTGGGTTCAGTGCCGCGTGGTTTATCTT
CCTGTTTCATACCTCTACGCAAATAAGGTTGCGATACCTTTAAATCCTCTCATTGCTAGCCTCCGCCAGGAAATC
TATACACAGTCATATGAGAGCATTCATTTTGAGAAACACCGGGATGCTGTGGCTGTCACCGACTTGAAGAAGCCA
CCGTCCAGTCTTCTTCGCGTTGCTAATATGTGCTTGCATTTCTGGGAGCAATATTTCCGGCCCAACTATGTCGCG
CAATGGGCTAATGAGCGGGTATATGAATTGATCCGGCGTGAAGATGAGAACACATCCTATAATTGTCTGGCTCCA
GTCAACAAAGCTTTCCATATGGTGAGCGTCTGGCACTCAGATGGTGCTACTAGTACGCGCATGCATCGCCATCGC
GAGGTCATACCGAGCTACATGTGGGTTGGCGAAGAGGGAATGACCTGCAGTGGAACGAATGGAGTCCAGGTCTGG
GATACAGCATTCAGCATCCAAGCTATGGTCGAGGCTGGAGTTTCCATGCTGCCAGAGTTTCGTTCTACACTGGAA
AAAGCCTTGAAGTACTTGGACATCTCTCAATTGAGGGAAGACCTGGCCGACGAGTACCGTCAGCCACGGAAAGGT
GGTTGGCCTTTTAGCACACGGAACAATGGGTATATTGTATCGGACTGTGCTGCAGAAGCACTCAAGGCCGTCTTG
ATGCTTCAAGAAGAGTGCCACTTCATCAAATTAATCTCCGATGACCGTCTGCAGGACTGTGTTGATAGTCTACTG
CTGATGCAAAACCCCGACGGTGGATTTAGCAGTTACGAACGTACTCGATCCAGCACTTTACTCGAACATCTCAAT
GCGTCGGAGGTATTCGATCGCATTATGGTCGAATACTCATACCCGGAGTGCACAACGGCAGTAGTCACAGCGTTA
TCACTTTTTAAGCAATACTTCCCCAGTTATCGAGCGAAGGAAATCAATGGAGTCATTGAGCGCGCGGTAAAATAT
GTTATAAAAGCACAACGGCCCGATGGAAGCTGGTATGGATCATGGGGGGTGTGTTTCACTTACGCGTCGTTCTTT
GCCATGCAATGTCTGGAACTGGTCGATCAGACATGGCAAAACAGCAGTCACGTTCGGAAGTGCTGCAAATTCCTT
CTCAGTAAACAAAAGGAAGATGGCGGCTGGGGCGAACATTATACCTCGTGTGAGCAAGAAGAGTGTGTTAACCAT
GAGCGGAGCCAGGTTGTAAATACTGCTTGGGCTTGCTTAGCATTGATGCACGCACGGTATCCGTACAAAGAGGAT
ATTGAAAAGGGGCTTAAGTTGATCATGAGTCGGCAGCAGAGAAATGGCGAGTGGTATCAAGAGGATGTAGAAGGT
GTCTTCAATAACACGTGCATGATTGGCTATCCCAACTACAAGCTCTATTTTACATCATGGGCCCTCGGGAGATAT
GTTCACATGTACCTTCCCATGCTTAAAAGGGAAGGTTATGAATACATTACTGCCCTGGACATCAAATTTTGA
Transcript >Ani_SJS72_1|g1762.t1
ATGCCAATGACTGCATCGACGACAGATCCCACGAGATGGCGTCTCATTGTGGATGAGGGTGTTCACCAATGGCGG
TATGTTAGCGAAGCCGACTCAGCACGTCGAGTACAGTCCACAGCAGAGAAATACTTTCTTGGATTGCCCACGGGA
TTGCCGTCACTCGAAATCCCACACAGCTTTCAGCAATCTGCTCGCAATGGTTTCCGTTTTTATCAAAAACTCCAG
CTGGATGATGGCCACTGGGGATGTGGTTATGGTGGCCCCAGCTTCTTACTTGCTGGTATTGTAATAGCGATGTAC
ATCACTGAGACGGACATTCCCTCTGAATGGAAGGCCGAGCTTCTCCGTTATCTTTCAAACACGGTCAATGAAGAT
GGTGGCTGGGGGCTACATGCTGCTGGTGCCTCCACCGTTTTCGCAACAACTCTCTATTATGTCACCTTGCGAATT
CTAGGGGTCCAGCCGAGTCATCCTCTCACTAGTAAGGCGCGTGTCCGCCTACACGCCCTAGGTGGGGCAGTCGGG
ATCCCGCAGTGGGGTAAGATCTGGCTGGCTCTGTTGAATCTTTACAGCTGGGGTGGAATCAATCCCATCCCCCCA
GAGCTGTGGTTGCTCCCCGATTGGATCCCATTCCATCCATGGCGTTGGTGGGTTCAGTGCCGCGTGGTTTATCTT
CCTGTTTCATACCTCTACGCAAATAAGGTTGCGATACCTTTAAATCCTCTCATTGCTAGCCTCCGCCAGGAAATC
TATACACAGTCATATGAGAGCATTCATTTTGAGAAACACCGGGATGCTGTGGCTGTCACCGACTTGAAGAAGCCA
CCGTCCAGTCTTCTTCGCGTTGCTAATATGTGCTTGCATTTCTGGGAGCAATATTTCCGGCCCAACTATGTCGCG
CAATGGGCTAATGAGCGGGTATATGAATTGATCCGGCGTGAAGATGAGAACACATCCTATAATTGTCTGGCTCCA
GTCAACAAAGCTTTCCATATGGTGAGCGTCTGGCACTCAGATGGTGCTACTAGTACGCGCATGCATCGCCATCGC
GAGGTCATACCGAGCTACATGTGGGTTGGCGAAGAGGGAATGACCTGCAGTGGAACGAATGGAGTCCAGGTCTGG
GATACAGCATTCAGCATCCAAGCTATGGTCGAGGCTGGAGTTTCCATGCTGCCAGAGTTTCGTTCTACACTGGAA
AAAGCCTTGAAGTACTTGGACATCTCTCAATTGAGGGAAGACCTGGCCGACGAGTACCGTCAGCCACGGAAAGGT
GGTTGGCCTTTTAGCACACGGAACAATGGGTATATTGTATCGGACTGTGCTGCAGAAGCACTCAAGGCCGTCTTG
ATGCTTCAAGAAGAGTGCCACTTCATCAAATTAATCTCCGATGACCGTCTGCAGGACTGTGTTGATAGTCTACTG
CTGATGCAAAACCCCGACGGTGGATTTAGCAGTTACGAACGTACTCGATCCAGCACTTTACTCGAACATCTCAAT
GCGTCGGAGGTATTCGATCGCATTATGGTCGAATACTCATACCCGGAGTGCACAACGGCAGTAGTCACAGCGTTA
TCACTTTTTAAGCAATACTTCCCCAGTTATCGAGCGAAGGAAATCAATGGAGTCATTGAGCGCGCGGTAAAATAT
GTTATAAAAGCACAACGGCCCGATGGAAGCTGGTATGGATCATGGGGGGTGTGTTTCACTTACGCGTCGTTCTTT
GCCATGCAATGTCTGGAACTGGTCGATCAGACATGGCAAAACAGCAGTCACGTTCGGAAGTGCTGCAAATTCCTT
CTCAGTAAACAAAAGGAAGATGGCGGCTGGGGCGAACATTATACCTCGTGTGAGCAAGAAGAGTGTGTTAACCAT
GAGCGGAGCCAGGTTGTAAATACTGCTTGGGCTTGCTTAGCATTGATGCACGCACGGTATCCGTACAAAGAGGAT
ATTGAAAAGGGGCTTAAGTTGATCATGAGTCGGCAGCAGAGAAATGGCGAGTGGTATCAAGAGGATGTAGAAGGT
GTCTTCAATAACACGTGCATGATTGGCTATCCCAACTACAAGCTCTATTTTACATCATGGGCCCTCGGGAGATAT
GTTCACATGTACCTTCCCATGCTTAAAAGGGAAGGTTATGAATACATTACTGCCCTGGACATCAAATTTTGA
Gene >Ani_SJS72_1|g1762.t1
ATGCCAATGACTGCATCGACGACAGATCCCACGAGATGGCGTCTCATTGTGGATGAGGGTGTTCACCAATGGCGG
TATGTTAGCGAAGCCGACTCAGCACGTCGAGTACAGTCCACAGCAGAGAAATACTTTCTTGGATTGCCCACGGTA
AGTGAACTGTCATCAGCAGCTAAGCTAGAGCTATGTTGGCTTACTTGTGCAGGGATTGCCGTCACTCGAAATCCC
ACACAGCTTTCAGCAATCTGCTCGCAATGGTTTCCGTTTTTATCAAAAACTCCAGCTGGATGATGGCCACTGGGG
ATGTGGTTATGGTGGCCCCAGCTTCTTACTTGCTGGTATTGTAATAGCGATGTACATCACTGAGACGGACATTCC
CTCTGAATGGAAGGCCGAGCTTCTCCGTTATCTTTCAAACACGGTCAATGAAGATGGTGGCTGGGGGCTACATGC
TGCTGGTGCCTCCACCGTTTTCGCAACAACTCTCTATTATGTCACCTTGCGAATTCTAGGGGTCCAGCCGAGTCA
TCCTCTCACTAGTAAGGCGCGTGTCCGCCTACACGCCCTAGGTAAGTGCATACATGTCTACTATCTATATAAACC
AGCCGAGGCTCAATATATGGATAGGTGGGGCAGTCGGGATCCCGCAGTGGGGTAAGATCTGGCTGGCTCTGTTGA
ATCTTTACAGCTGGGGTGGAATCAATCCCATCCCCCCAGAGCTGTGGTATGATAATCCCTTCAATGGCGTTGCCT
ATGAATTGTAACCCTGGCAGAGCTGATAAGGGTCTAGGTTGCTCCCCGATTGGATCCCATTCCATCCATGGCGTT
GGTGGGTTCAGTGCCGCGTGGTTTATCTTCCTGTTTCATACCTCTACGCAAATAAGGTTGCGATACCTTTAAATC
CTCTCATTGCTAGCCTCCGCCAGGAAATCTATACACAGTCATATGAGAGCATTCATTTTGAGAAACACCGGGATG
CTGTGGCTGTCACCGACTTGAAGAAGCCACCGTCCAGTCTTCTTCGCGTTGCTAATATGTGCTTGCATTTCTGGG
AGCAATATTTCCGGCCCAACTATGTCGCGCAATGGGCTAATGAGCGGGTATATGAATTGATCCGGCGTGAAGATG
AGAACACATCCTATAATTGTCTGGCTCCAGTCAACAAAGCTTTCCATATGGTGAGCGTCTGGCACTCAGATGGTG
CTACTAGTACGCGCATGCATCGCCATCGCGAGGTCATACCGAGCTACATGTGGGTTGGCGAAGAGGGAATGACCT
GCAGTGGAACGAATGGAGTCCAGGTCTGGGATACAGCATTCAGCATCCAAGCTATGGTCGAGGCTGGAGTTTCCA
TGCTGCCAGAGTTTCGTTCTACACTGGAAAAAGCCTTGAAGTACTTGGACATCTCTCAATTGAGGGAAGACCTGG
CCGACGAGTACCGTCAGCCACGGAAAGGTGGTTGGCCTTTTAGCACACGGAACAATGGGTATATTGTATCGGACT
GTGCTGCAGAAGCACTCAAGGCCGTCTTGATGCTTCAAGAAGAGTGGTGAGTTTTCAAATATCTTACCGTTTGAA
GAAAAGGAGCTTGACTTCTAATTTGTATCTCAGCCACTTCATCAAATTAATCTCCGATGACCGTCTGCAGGACTG
TGTTGATAGTCTACTGCTGATGCAAAACCCCGACGGTGGATTTAGCAGTTACGAACGTACTCGATCCAGCACTTT
ACTCGAACATCTCAATGCGTCGGAGGTATTCGATCGCATTATGGTCGAATACTCATACCCGGAGTGCACAACGGC
AGTAGTCACAGCGTTATCACTTTTTAAGCAATACTTCCCCAGTTATCGAGCGAAGGAAATCAATGGAGTCATTGA
GCGCGCGGTAAAATATGTTATAAAAGCACAACGGCCCGATGGAAGCTGGTATGGATCATGGGGGGTGTGTTTCAC
TTACGCGTCGTTCTTTGCCATGCAATGTCTGGAACTGGTCGATCAGACATGGCAAAACAGCAGTCACGTTCGGAA
GTGCTGCAAATTCCTTCTCAGTAAACAAAAGGAAGATGGCGGCTGGGGCGAACATTATACCTCGTGTGAGCAAGA
AGAGTGTGTTAACCATGAGCGGAGCCAGGTTGTAAATACTGCTTGGGCTTGCTTAGCATTGATGCACGCACGGTA
TCCGTACAAAGAGGATATTGAAAAGGGGCTTAAGGTACAATCAATAATCTCCTTATTGCCTTCAAGTGATCAGCC
GGTGCATTCGGAGTACATACTGACGAAACACTCTGCAGTTGATCATGAGTCGGCAGCAGAGAAATGGCGAGTGGT
ATCAAGAGGATGTAGAAGGTGTCTTCAATAACACGTGGTGAGTATTTGACCTTGGTCTCATTGCAGCTTAGCACA
AACTAATTATTTTCAATCTAGCATGATTGGCTATCCCAACTACAAGCTCTATTTTACATCATGGGCCCTCGGGAG
ATATGTTCACATGTACCTTCCCATGCTTAAAAGGGAAGGTTATGAGTAAGTGCCTATGCGTTTTGTTGTCATGGA
TATATCGACACTGTATTAATAGATACATTACTGCCCTGGACATCAAATTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail