Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g1761.t1
Gene name
Locationscaffold_008:245928..246918
Strand-
Gene length (bp)990
Transcript length (bp)792
Coding sequence length (bp)792
Protein length (aa) 264

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07264 EI24 Etoposide-induced protein 2.4 (EI24) 4.9E-13 33 243

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 58 80 22
2 90 112 22
3 166 188 22
4 223 245 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g1761.t1
MNKITGALIDEATHIRAIAKDVVLSGTYFYPIKGIIYTLNRPTLRQPLLSRSSKTLTLGVGVTTAMFFFTYVPQA
AIMSITSGPLLAPFSAALLVLSESSTITTFLARSFLLADAITATFDATLVEMGQEKLLEQSGKSSGDDAISRLGS
KEEVEERQTNMWNMLVRSVVLLPLNFVPVVGTVMYVYVQGKKVGEGVHERWFALKGWKKGDRARWVGRWRGKYTG
FGMAAFALEMVPFVSIAFAFTNTVGAALWAADWEKSLQ*
Coding >Ani_SJS72_1|g1761.t1
ATGAACAAAATTACTGGAGCTCTCATCGACGAAGCAACCCACATCCGGGCCATCGCCAAAGATGTCGTCCTCTCA
GGGACATATTTCTACCCAATTAAGGGAATAATCTACACCCTCAACCGCCCCACCCTCCGCCAACCCCTCCTCTCC
CGCTCCTCCAAAACCCTCACCCTCGGCGTGGGCGTCACCACAGCCATGTTCTTCTTCACTTACGTGCCCCAAGCA
GCCATCATGTCCATTACCAGTGGGCCCCTCCTCGCCCCCTTCTCCGCCGCATTACTCGTCCTCAGCGAGTCTTCC
ACCATCACGACCTTCCTCGCGAGGTCGTTTCTCCTCGCGGATGCGATCACCGCTACGTTTGATGCGACGCTCGTA
GAGATGGGTCAGGAGAAACTACTTGAACAGTCTGGAAAGAGTAGTGGTGATGATGCTATCTCCCGCCTCGGGAGC
AAGGAAGAAGTCGAGGAAAGACAAACGAACATGTGGAATATGTTGGTGAGGAGTGTGGTATTGCTGCCATTGAAC
TTCGTTCCTGTTGTGGGAACGGTGATGTATGTTTATGTGCAGGGGAAGAAGGTCGGTGAGGGGGTGCATGAGCGG
TGGTTTGCGTTGAAGGGGTGGAAGAAGGGGGATAGGGCGAGATGGGTCGGGAGGTGGAGGGGGAAGTATACTGGG
TTTGGGATGGCGGCGTTCGCGCTGGAAATGGTCCCGTTTGTGTCGATTGCGTTTGCGTTTACGAATACGGTCGGG
GCGGCGTTGTGGGCGGCGGATTGGGAGAAATCGTTGCAGTAG
Transcript >Ani_SJS72_1|g1761.t1
ATGAACAAAATTACTGGAGCTCTCATCGACGAAGCAACCCACATCCGGGCCATCGCCAAAGATGTCGTCCTCTCA
GGGACATATTTCTACCCAATTAAGGGAATAATCTACACCCTCAACCGCCCCACCCTCCGCCAACCCCTCCTCTCC
CGCTCCTCCAAAACCCTCACCCTCGGCGTGGGCGTCACCACAGCCATGTTCTTCTTCACTTACGTGCCCCAAGCA
GCCATCATGTCCATTACCAGTGGGCCCCTCCTCGCCCCCTTCTCCGCCGCATTACTCGTCCTCAGCGAGTCTTCC
ACCATCACGACCTTCCTCGCGAGGTCGTTTCTCCTCGCGGATGCGATCACCGCTACGTTTGATGCGACGCTCGTA
GAGATGGGTCAGGAGAAACTACTTGAACAGTCTGGAAAGAGTAGTGGTGATGATGCTATCTCCCGCCTCGGGAGC
AAGGAAGAAGTCGAGGAAAGACAAACGAACATGTGGAATATGTTGGTGAGGAGTGTGGTATTGCTGCCATTGAAC
TTCGTTCCTGTTGTGGGAACGGTGATGTATGTTTATGTGCAGGGGAAGAAGGTCGGTGAGGGGGTGCATGAGCGG
TGGTTTGCGTTGAAGGGGTGGAAGAAGGGGGATAGGGCGAGATGGGTCGGGAGGTGGAGGGGGAAGTATACTGGG
TTTGGGATGGCGGCGTTCGCGCTGGAAATGGTCCCGTTTGTGTCGATTGCGTTTGCGTTTACGAATACGGTCGGG
GCGGCGTTGTGGGCGGCGGATTGGGAGAAATCGTTGCAGTAG
Gene >Ani_SJS72_1|g1761.t1
ATGAACAAAATTACTGGAGCTCTCATCGACGAAGCAACCCACATCCGGGCCATCGCCAAAGATGTCGTCCTCTCA
GGGACATATTTCTACCCAATTAAGGTGCACTTCCACCACCTGAACCAACCACATCCCCCCATCCCCCATACAGAC
ATCCATAGCTACTATACCTACACCGAATAAACCACCCCCAACCCAATACTAAATATCAATATAGGGAATAATCTA
CACCCTCAACCGCCCCACCCTCCGCCAACCCCTCCTCTCCCGCTCCTCCAAAACCCTCACCCTCGGCGTGGGCGT
CACCACAGCCATGTTCTTCTTCACTTACGTGCCCCAAGCAGCCATCATGTCCATTACCAGTGGGCCCCTCCTCGC
CCCCTTCTCCGCCGCATTACTCGTCCTCAGCGAGTCTTCCACCATCACGACCTTCCTCGCGAGGTCGTTTCTCCT
CGCGGATGCGATCACCGCTACGTTTGATGCGACGCTCGTAGAGATGGGTCAGGAGAAACTACTTGAACAGTCTGG
AAAGAGTAGTGGTGATGATGCTATCTCCCGCCTCGGGAGCAAGGAAGAAGTCGAGGAAAGACAAACGAACATGTG
GAATATGTTGGTGAGGAGTGTGGTATTGCTGCCATTGAACTTCGTTCCTGTTGTGGGAACGGTGATGTATGTTTA
TGTGCAGGGGAAGAAGGTCGGTGAGGGGGTGCATGAGCGGTGGTTTGCGTTGAAGGGGTGGAAGAAGGGGGATAG
GGCGAGATGGGTCGGGAGGTGGAGGGGGAAGTATACTGGGTATGTTTTATCTTTTCTTTTTTCCCCCTTGGGGTG
GTAGTATATTTGGGGGTGTGGGTGATGGCTGACTGACTGCTGGGTAGGTTTGGGATGGCGGCGTTCGCGCTGGAA
ATGGTCCCGTTTGTGTCGATTGCGTTTGCGTTTACGAATACGGTCGGGGCGGCGTTGTGGGCGGCGGATTGGGAG
AAATCGTTGCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail