Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g1741.t1
Gene name
Locationscaffold_008:178941..180898
Strand-
Gene length (bp)1957
Transcript length (bp)1641
Coding sequence length (bp)1641
Protein length (aa) 547

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.8E-33 65 461
PF00083 Sugar_tr Sugar (and other) transporter 9.8E-06 115 250

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

Domain # Start End Length
1 58 80 22
2 95 117 22
3 124 146 22
4 150 172 22
5 184 206 22
6 211 233 22
7 324 346 22
8 366 388 22
9 409 431 22
10 435 457 22
11 470 492 22
12 502 524 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g1741.t1
MARSDAIDTDVPGTVYLVDATGSLRDVAHARTQDVLLIPQPTSFSADPLNWPLYKKYWTLFLISMYACVNSFGEN
NWGAAWTTISDDTGVSLNNMNGGSALNYLMLGFFNIIWIPTAMRFGRKIVYILSLLFVLGSGIWGGFYQGVSQYY
IMMVVNGIGTAAYQALIQLTIFDVFFTHERGRMLSIYIFFQQLGSIIGLICGGYISDGIGWRWSMPIVSIACAVL
ILLFIFTFDDTMFPRYRFSGETPQRTTKAENETARTPSDTPTTEGKDSKVEPPMSIVESRTVGEMDMPPRTYLQK
MSPVHYFKDDNTTWYQYFRRPFFLFAFPNILLAGIQFAFGCTAGIVSFNTISEIMTEAPYNWSAGSAGLIFLAAL
VGNFLGMGIGSLSDWVVVFLARRNKGYKEPEMRLWTYSIPLVLAAVGYFAYGWGATEGLHWMSIAVGLCCMIAQQ
VSATSIATAYAMECFEQISGELVIVLACCSSIINFVISFTVQDFIDGTNYGWTFTFYGIMVVLSMAAGAPMIIWG
KDWRRKCKPRYEKFLAETGRQ*
Coding >Ani_SJS72_1|g1741.t1
ATGGCTCGCTCTGATGCTATAGATACAGATGTTCCAGGAACGGTGTACCTGGTTGATGCAACGGGGAGTTTGAGA
GATGTAGCTCATGCTAGGACACAAGATGTCCTTCTTATCCCTCAGCCTACATCCTTTTCAGCTGATCCTCTGAAT
TGGCCTCTTTACAAGAAATACTGGACCCTCTTCTTGATCTCCATGTATGCATGCGTTAACTCCTTTGGGGAGAAC
AACTGGGGTGCAGCATGGACAACTATATCTGATGATACTGGTGTGAGCCTGAACAATATGAACGGTGGCTCCGCT
CTAAATTATCTTATGTTGGGTTTCTTCAACATTATCTGGATCCCCACGGCCATGAGATTTGGACGCAAAATTGTC
TACATACTTAGTCTGCTGTTCGTCCTTGGAAGTGGTATCTGGGGTGGCTTCTATCAGGGTGTTTCGCAATACTAC
ATTATGATGGTGGTCAACGGGATCGGAACTGCGGCCTATCAAGCTCTGATCCAGCTGACTATTTTCGACGTGTTT
TTCACTCATGAGCGTGGCCGAATGCTGTCCATCTATATTTTCTTTCAACAGCTTGGATCTATTATCGGGCTGATC
TGTGGCGGTTACATTTCTGACGGCATTGGCTGGAGATGGAGTATGCCCATCGTGTCTATAGCATGCGCTGTCTTG
ATTCTTCTCTTCATCTTTACTTTTGATGATACGATGTTCCCGAGGTATCGCTTTTCGGGTGAGACACCTCAGCGA
ACCACCAAGGCCGAAAACGAGACAGCTCGCACCCCATCTGACACCCCAACCACGGAGGGAAAAGATTCCAAGGTT
GAACCGCCGATGTCCATCGTGGAAAGTCGCACTGTCGGGGAGATGGACATGCCTCCGCGAACCTACCTCCAAAAG
ATGTCTCCGGTTCACTACTTCAAAGACGACAACACAACTTGGTACCAGTACTTTCGCCGTCCCTTCTTTCTTTTC
GCGTTTCCCAATATTCTTCTAGCCGGTATTCAATTTGCATTTGGCTGCACTGCAGGTATTGTCTCGTTTAATACC
ATCTCTGAGATCATGACGGAGGCACCATATAACTGGAGTGCCGGTTCTGCTGGCCTAATCTTCTTGGCAGCACTG
GTTGGTAACTTTCTTGGCATGGGTATTGGATCACTGTCCGATTGGGTTGTCGTCTTTTTGGCACGTCGGAACAAG
GGTTATAAGGAACCCGAGATGCGTTTATGGACGTATTCTATCCCCCTTGTACTTGCTGCGGTTGGCTATTTCGCC
TACGGCTGGGGTGCTACCGAGGGGCTTCACTGGATGTCCATTGCAGTTGGCCTGTGCTGCATGATTGCTCAGCAG
GTATCCGCCACCAGTATCGCAACCGCATACGCAATGGAGTGCTTCGAACAGATCTCTGGTGAGCTCGTCATTGTA
CTGGCATGCTGCTCATCGATAATCAACTTTGTCATCTCCTTTACGGTGCAGGATTTCATCGACGGCACCAACTAC
GGCTGGACCTTTACCTTCTATGGTATCATGGTTGTCCTTTCGATGGCTGCGGGTGCTCCGATGATTATCTGGGGT
AAGGATTGGCGGCGGAAATGTAAGCCTCGGTATGAGAAGTTTTTGGCCGAAACAGGACGTCAGTGA
Transcript >Ani_SJS72_1|g1741.t1
ATGGCTCGCTCTGATGCTATAGATACAGATGTTCCAGGAACGGTGTACCTGGTTGATGCAACGGGGAGTTTGAGA
GATGTAGCTCATGCTAGGACACAAGATGTCCTTCTTATCCCTCAGCCTACATCCTTTTCAGCTGATCCTCTGAAT
TGGCCTCTTTACAAGAAATACTGGACCCTCTTCTTGATCTCCATGTATGCATGCGTTAACTCCTTTGGGGAGAAC
AACTGGGGTGCAGCATGGACAACTATATCTGATGATACTGGTGTGAGCCTGAACAATATGAACGGTGGCTCCGCT
CTAAATTATCTTATGTTGGGTTTCTTCAACATTATCTGGATCCCCACGGCCATGAGATTTGGACGCAAAATTGTC
TACATACTTAGTCTGCTGTTCGTCCTTGGAAGTGGTATCTGGGGTGGCTTCTATCAGGGTGTTTCGCAATACTAC
ATTATGATGGTGGTCAACGGGATCGGAACTGCGGCCTATCAAGCTCTGATCCAGCTGACTATTTTCGACGTGTTT
TTCACTCATGAGCGTGGCCGAATGCTGTCCATCTATATTTTCTTTCAACAGCTTGGATCTATTATCGGGCTGATC
TGTGGCGGTTACATTTCTGACGGCATTGGCTGGAGATGGAGTATGCCCATCGTGTCTATAGCATGCGCTGTCTTG
ATTCTTCTCTTCATCTTTACTTTTGATGATACGATGTTCCCGAGGTATCGCTTTTCGGGTGAGACACCTCAGCGA
ACCACCAAGGCCGAAAACGAGACAGCTCGCACCCCATCTGACACCCCAACCACGGAGGGAAAAGATTCCAAGGTT
GAACCGCCGATGTCCATCGTGGAAAGTCGCACTGTCGGGGAGATGGACATGCCTCCGCGAACCTACCTCCAAAAG
ATGTCTCCGGTTCACTACTTCAAAGACGACAACACAACTTGGTACCAGTACTTTCGCCGTCCCTTCTTTCTTTTC
GCGTTTCCCAATATTCTTCTAGCCGGTATTCAATTTGCATTTGGCTGCACTGCAGGTATTGTCTCGTTTAATACC
ATCTCTGAGATCATGACGGAGGCACCATATAACTGGAGTGCCGGTTCTGCTGGCCTAATCTTCTTGGCAGCACTG
GTTGGTAACTTTCTTGGCATGGGTATTGGATCACTGTCCGATTGGGTTGTCGTCTTTTTGGCACGTCGGAACAAG
GGTTATAAGGAACCCGAGATGCGTTTATGGACGTATTCTATCCCCCTTGTACTTGCTGCGGTTGGCTATTTCGCC
TACGGCTGGGGTGCTACCGAGGGGCTTCACTGGATGTCCATTGCAGTTGGCCTGTGCTGCATGATTGCTCAGCAG
GTATCCGCCACCAGTATCGCAACCGCATACGCAATGGAGTGCTTCGAACAGATCTCTGGTGAGCTCGTCATTGTA
CTGGCATGCTGCTCATCGATAATCAACTTTGTCATCTCCTTTACGGTGCAGGATTTCATCGACGGCACCAACTAC
GGCTGGACCTTTACCTTCTATGGTATCATGGTTGTCCTTTCGATGGCTGCGGGTGCTCCGATGATTATCTGGGGT
AAGGATTGGCGGCGGAAATGTAAGCCTCGGTATGAGAAGTTTTTGGCCGAAACAGGACGTCAGTGA
Gene >Ani_SJS72_1|g1741.t1
ATGGCTCGCTCTGATGCTATAGATACAGATGTTCCAGGAACGGTGTACCTGGTTGATGGTAGGCTCTTTCTATAA
GCTGCATTTAATCACTACTGACGTCGAACTCAGCAACGGGGAGTTTGAGAGATGTAGCTCATGCTAGGACACAAG
ATGTCCTTCTTATCCCTCAGCCTACATCCTTTTCAGCTGATCCTCTGGTGGGTAGCAGATGAAGGGAACCTATGC
CACTTAGTTCGTGCTGACCCAATTTAGAATTGGCCTCTTTACAAGAAATACTGGACCCTCTTCTTGATCTCCATG
TATGCATGCGTTAACTCCTTTGGGGAGAACAACTGGGGTGCAGCATGGACAACTATATCTGATGATACTGGTGTG
AGCCTGAACAATATGAACGGTGGCTCCGCTCTAAATTATCTTATGTTGGGTTTCTTCAACATTATCTGGATCCCC
ACGGCCATGAGATTTGGACGCAAAATTGTCTACATACTTAGTCTGCTGTTCGTCCTTGGAAGTGGTATCTGGGGT
GGCTTCTATCAGGGTGTTTCGCAATACTACATTATGATGGTGGTCAACGGGATCGGAACTGCGGCCTATCAAGCT
CTGATCCAGCTGACTGTATGCTACGTTTCTGAAATGCTCACTTCGGTATGCTAACACATCTTAGATTTTCGACGT
GTTTTTCACTCATGAGCGTGGCCGAATGCTGTCCATCTATATTTTCTTTCAACAGCTTGGATCTATTATCGGGCT
GATCTGTGGCGGTTACATTTCTGACGGCATTGGCTGGAGATGGAGTATGCCCATCGTGTCTATAGCATGCGTCAG
TGTCCTTGTACCCAGATTAGTCTGCTATACTCAGACAGCTAACTTTTAACAGGCTGTCTTGATTCTTCTCTTCAT
CTTTACTTTTGATGATACGATGTTCCCGAGGTATCGCTTTTCGGGTGAGACACCTCAGCGAACCACCAAGGCCGA
AAACGAGACAGCTCGCACCCCATCTGACACCCCAACCACGGAGGGAAAAGATTCCAAGGTTGAACCGCCGATGTC
CATCGTGGAAAGTCGCACTGTCGGGGAGATGGACATGCCTCCGCGAACCTACCTCCAAAAGATGTCTCCGGTTCA
CTACTTCAAAGACGACAACACAACTTGGTACCAGTACTTTCGCCGTCCCTTCTTTCTTTTCGCGTTTCCCAATAT
TCTTCTAGCCGGTATTCAATTTGCATTTGGCTGCACTGCAGGTATTGTCTCGTTTAATACCATCTCTGAGATCAT
GACGGAGGCACCATATAACTGGAGTGCCGGTTCTGCTGGCCTAATCTTCTTGGCAGCACTGGTTGGTAACTTTCT
TGGGTATGATGTATCCTATCACTAGTTTCATGAAAAATGCTAATCTTGTGACAGCATGGGTATTGGATCACTGTC
CGATTGGGTTGTCGTCTTTTTGGCACGTCGGAACAAGGGTTATAAGGAACCCGAGATGCGTTTATGGACGTATTC
TATCCCCCTTGTACTTGCTGCGGTTGGCTATTTCGCCTACGGCTGGGGTGCTACCGAGGGGCTTCACTGGATGTC
CATTGCAGTTGGCCTGTGCTGCATGATTGCTCAGCAGGTATCCGCCACCAGTATCGCAACCGCATACGCAATGGA
GTGCTTCGAACAGGTAAGCCTTTTACATCCACAATCTTGTACTAGGTGGCTAATGCTCTCCGTCCAGATCTCTGG
TGAGCTCGTCATTGTACTGGCATGCTGCTCATCGATAATCAACTTTGTCATCTCCTTTACGGTGCAGGATTTCAT
CGACGGCACCAACTACGGCTGGACCTTTACCTTCTATGGTATCATGGTTGTCCTTTCGATGGCTGCGGGTGCTCC
GATGATTATCTGGGGTAAGGATTGGCGGCGGAAATGTAAGCCTCGGTATGAGAAGTTTTTGGCCGAAACAGGACG
TCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail