Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g159.t1
Gene name
Locationscaffold_001:472562..474154
Strand-
Gene length (bp)1592
Transcript length (bp)1452
Coding sequence length (bp)1452
Protein length (aa) 484

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01222 ERG4_ERG24 Ergosterol biosynthesis ERG4/ERG24 family 5.0E-148 7 483

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor Yes
GO:0016126 sterol biosynthetic process Yes
GO:0016125 sterol metabolic process No
GO:0008202 steroid metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0016491 oxidoreductase activity No
GO:0006694 steroid biosynthetic process No
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors No
GO:1901362 organic cyclic compound biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0006629 lipid metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901615 organic hydroxy compound metabolic process No
GO:0003824 catalytic activity No
GO:1901617 organic hydroxy compound biosynthetic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 76 94 18
3 115 137 22
4 152 174 22
5 247 266 19
6 281 303 22
7 316 338 22
8 389 411 22
9 432 449 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g159.t1
MASSTVVEYEFGGPLGAAAITIGLPLLLYFFAFGCNDVSGCPVPSLLSPRTFTWEKWTAETGWPEGGIWGLFDWK
VTGAVLAYYFFILLLWRLLPAQKVHGTKLVHHGRPLEYRMNAFPTSVVVFALCAIGTYFKGADFAVWTYIADHYV
QMLTANLLISFALATYLYIRSFGVDTNYPNRDLRELAAGGKTGNVIYDFYIGRELNPRVTLPFFGEIDIKTWCEM
YPGLTGWILLDLAFVAKQYRTYGYASDSILLIAFFQGFYVLNSHYNELGLLVMMDTTTDGMGFMLSFGDLLWVPF
LYSTQCRYLAVYPLQLGWFNVAAVSAVFALGLYIFRAANDQKHMFRTHPNNPSVAGLSYIQTKRGTRLLTAGWWG
MSRHINYFGDWLQALPFSLPTGMAGYLIYPAGSLVAASQSFQMTDGRKVVQGEAQGWGIIFTYFYVLYFAILLMH
RERRDDAMCAAKYGEDWEKYRRTVRWRILPWVY*
Coding >Ani_SJS72_1|g159.t1
ATGGCTTCCTCGACGGTGGTTGAATACGAGTTTGGTGGACCCCTAGGAGCCGCTGCCATTACCATTGGCCTACCT
TTGCTCCTGTACTTCTTTGCCTTCGGCTGTAACGATGTATCAGGCTGTCCTGTGCCTTCGCTGTTGAGCCCTCGT
ACTTTCACTTGGGAGAAATGGACCGCGGAGACCGGGTGGCCTGAAGGTGGAATATGGGGGCTCTTCGACTGGAAA
GTGACCGGTGCAGTGCTGGCATACTATTTCTTTATCTTGCTTCTCTGGAGGCTCCTCCCAGCACAAAAGGTTCAT
GGAACTAAACTGGTCCATCATGGCCGTCCGCTTGAATATCGCATGAATGCGTTCCCGACCAGCGTTGTCGTTTTT
GCTCTCTGTGCAATTGGCACATACTTCAAAGGCGCCGACTTCGCTGTATGGACGTATATTGCAGATCACTATGTG
CAGATGTTGACGGCCAATTTATTGATATCATTTGCACTCGCCACCTACCTCTACATCCGCAGCTTCGGCGTGGAC
ACCAATTACCCCAATAGAGATCTTCGCGAACTAGCAGCCGGCGGGAAGACAGGCAACGTTATCTACGATTTCTAC
ATTGGTCGGGAATTGAACCCCCGTGTCACTCTTCCATTCTTCGGGGAGATCGACATCAAGACTTGGTGCGAGATG
TATCCTGGCTTGACCGGCTGGATCCTGCTTGATCTTGCCTTTGTCGCCAAGCAGTATCGCACTTATGGCTATGCC
TCCGACAGTATTCTGTTGATCGCCTTCTTCCAGGGATTTTACGTGCTCAACAGCCATTACAATGAATTAGGGCTT
CTGGTTATGATGGATACCACCACTGATGGCATGGGATTTATGCTCTCCTTTGGCGATCTTCTCTGGGTGCCCTTT
CTTTACTCAACACAATGCCGTTATTTGGCTGTCTACCCTTTGCAGCTGGGGTGGTTCAATGTCGCAGCTGTGAGC
GCCGTCTTTGCCCTGGGACTGTACATCTTCCGGGCCGCAAACGACCAGAAGCACATGTTCCGCACGCACCCCAAC
AATCCGAGTGTGGCAGGCCTGTCGTACATTCAAACTAAGCGCGGAACTAGACTGCTCACAGCTGGATGGTGGGGG
ATGTCTCGGCATATCAACTACTTTGGGGACTGGCTACAAGCATTGCCCTTTAGTTTGCCTACGGGAATGGCAGGA
TATCTGATTTACCCGGCAGGGAGTCTTGTGGCTGCCTCACAGAGCTTCCAGATGACAGACGGGCGCAAGGTCGTC
CAGGGTGAAGCCCAAGGTTGGGGAATAATCTTCACCTATTTCTACGTACTGTACTTTGCAATCCTGTTGATGCAT
CGGGAACGCAGAGACGATGCTATGTGTGCGGCAAAGTATGGCGAAGACTGGGAGAAGTACCGGCGGACGGTCCGG
TGGAGAATCCTCCCCTGGGTTTACTAG
Transcript >Ani_SJS72_1|g159.t1
ATGGCTTCCTCGACGGTGGTTGAATACGAGTTTGGTGGACCCCTAGGAGCCGCTGCCATTACCATTGGCCTACCT
TTGCTCCTGTACTTCTTTGCCTTCGGCTGTAACGATGTATCAGGCTGTCCTGTGCCTTCGCTGTTGAGCCCTCGT
ACTTTCACTTGGGAGAAATGGACCGCGGAGACCGGGTGGCCTGAAGGTGGAATATGGGGGCTCTTCGACTGGAAA
GTGACCGGTGCAGTGCTGGCATACTATTTCTTTATCTTGCTTCTCTGGAGGCTCCTCCCAGCACAAAAGGTTCAT
GGAACTAAACTGGTCCATCATGGCCGTCCGCTTGAATATCGCATGAATGCGTTCCCGACCAGCGTTGTCGTTTTT
GCTCTCTGTGCAATTGGCACATACTTCAAAGGCGCCGACTTCGCTGTATGGACGTATATTGCAGATCACTATGTG
CAGATGTTGACGGCCAATTTATTGATATCATTTGCACTCGCCACCTACCTCTACATCCGCAGCTTCGGCGTGGAC
ACCAATTACCCCAATAGAGATCTTCGCGAACTAGCAGCCGGCGGGAAGACAGGCAACGTTATCTACGATTTCTAC
ATTGGTCGGGAATTGAACCCCCGTGTCACTCTTCCATTCTTCGGGGAGATCGACATCAAGACTTGGTGCGAGATG
TATCCTGGCTTGACCGGCTGGATCCTGCTTGATCTTGCCTTTGTCGCCAAGCAGTATCGCACTTATGGCTATGCC
TCCGACAGTATTCTGTTGATCGCCTTCTTCCAGGGATTTTACGTGCTCAACAGCCATTACAATGAATTAGGGCTT
CTGGTTATGATGGATACCACCACTGATGGCATGGGATTTATGCTCTCCTTTGGCGATCTTCTCTGGGTGCCCTTT
CTTTACTCAACACAATGCCGTTATTTGGCTGTCTACCCTTTGCAGCTGGGGTGGTTCAATGTCGCAGCTGTGAGC
GCCGTCTTTGCCCTGGGACTGTACATCTTCCGGGCCGCAAACGACCAGAAGCACATGTTCCGCACGCACCCCAAC
AATCCGAGTGTGGCAGGCCTGTCGTACATTCAAACTAAGCGCGGAACTAGACTGCTCACAGCTGGATGGTGGGGG
ATGTCTCGGCATATCAACTACTTTGGGGACTGGCTACAAGCATTGCCCTTTAGTTTGCCTACGGGAATGGCAGGA
TATCTGATTTACCCGGCAGGGAGTCTTGTGGCTGCCTCACAGAGCTTCCAGATGACAGACGGGCGCAAGGTCGTC
CAGGGTGAAGCCCAAGGTTGGGGAATAATCTTCACCTATTTCTACGTACTGTACTTTGCAATCCTGTTGATGCAT
CGGGAACGCAGAGACGATGCTATGTGTGCGGCAAAGTATGGCGAAGACTGGGAGAAGTACCGGCGGACGGTCCGG
TGGAGAATCCTCCCCTGGGTTTACTAG
Gene >Ani_SJS72_1|g159.t1
ATGGCTTCCTCGACGGTGGTTGAATACGAGTTTGGTGGACCGTAAGCACGCACCTACCCCGGACCCTATCTAGCC
TTGACAATATAGACTGAATTGCCGGTAGCCTAGGAGCCGCTGCCATTACCATTGGCCTACCTTTGCTCCTGTACT
TCTTTGCCTTCGGCTGTAACGATGTATCAGGCTGTCCTGTGCCTTCGCTGTTGAGCCCTCGTACTTTCACTTGGG
AGAAATGGACCGCGGAGACCGGGTGGCCTGAAGGTGGAATATGGGGGCTCTTCGACTGGAAAGTGACCGGTGCAG
TGCTGGCATACTATTTCTTTATCTTGCTTCTCTGGAGGCTCCTCCCAGCACAAAAGGTTCATGGAACTAAACTGG
TCCATCATGGCCGTCCGCTTGAATATCGCATGAATGGTAAATATACTTATACTATCTGTGAACCCCGGCTGCCAT
ATGCTTCACTGGAACTGCGCTGACCACAACACTTGACAGCGTTCCCGACCAGCGTTGTCGTTTTTGCTCTCTGTG
CAATTGGCACATACTTCAAAGGCGCCGACTTCGCTGTATGGACGTATATTGCAGATCACTATGTGCAGATGTTGA
CGGCCAATTTATTGATATCATTTGCACTCGCCACCTACCTCTACATCCGCAGCTTCGGCGTGGACACCAATTACC
CCAATAGAGATCTTCGCGAACTAGCAGCCGGCGGGAAGACAGGCAACGTTATCTACGATTTCTACATTGGTCGGG
AATTGAACCCCCGTGTCACTCTTCCATTCTTCGGGGAGATCGACATCAAGACTTGGTGCGAGATGTATCCTGGCT
TGACCGGCTGGATCCTGCTTGATCTTGCCTTTGTCGCCAAGCAGTATCGCACTTATGGCTATGCCTCCGACAGTA
TTCTGTTGATCGCCTTCTTCCAGGGATTTTACGTGCTCAACAGCCATTACAATGAATTAGGGCTTCTGGTTATGA
TGGATACCACCACTGATGGCATGGGATTTATGCTCTCCTTTGGCGATCTTCTCTGGGTGCCCTTTCTTTACTCAA
CACAATGCCGTTATTTGGCTGTCTACCCTTTGCAGCTGGGGTGGTTCAATGTCGCAGCTGTGAGCGCCGTCTTTG
CCCTGGGACTGTACATCTTCCGGGCCGCAAACGACCAGAAGCACATGTTCCGCACGCACCCCAACAATCCGAGTG
TGGCAGGCCTGTCGTACATTCAAACTAAGCGCGGAACTAGACTGCTCACAGCTGGATGGTGGGGGATGTCTCGGC
ATATCAACTACTTTGGGGACTGGCTACAAGCATTGCCCTTTAGTTTGCCTACGGGAATGGCAGGATATCTGATTT
ACCCGGCAGGGAGTCTTGTGGCTGCCTCACAGAGCTTCCAGATGACAGACGGGCGCAAGGTCGTCCAGGGTGAAG
CCCAAGGTTGGGGAATAATCTTCACCTATTTCTACGTACTGTACTTTGCAATCCTGTTGATGCATCGGGAACGCA
GAGACGATGCTATGTGTGCGGCAAAGTATGGCGAAGACTGGGAGAAGTACCGGCGGACGGTCCGGTGGAGAATCC
TCCCCTGGGTTTACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail