Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g1573.t1
Gene name
Locationscaffold_007:288329..292856
Strand-
Gene length (bp)4527
Transcript length (bp)4527
Coding sequence length (bp)4527
Protein length (aa) 1509

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00005 ABC_tran ABC transporter 6.2E-19 614 748
PF00005 ABC_tran ABC transporter 2.2E-29 1239 1420
PF00664 ABC_membrane ABC transporter transmembrane region 5.6E-15 277 551
PF00664 ABC_membrane ABC transporter transmembrane region 4.5E-25 926 1169

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0140359 ABC-type transporter activity Yes
GO:0005524 ATP binding Yes
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0022804 active transmembrane transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0000166 nucleotide binding No
GO:0005488 binding No
GO:0032553 ribonucleotide binding No
GO:0043168 anion binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0009987 cellular process No
GO:0030554 adenyl nucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0140657 ATP-dependent activity No
GO:0005575 cellular_component No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 76 98 22
3 108 125 17
4 132 151 19
5 166 188 22
6 275 297 22
7 312 334 22
8 394 416 22
9 421 443 22
10 508 530 22
11 545 567 22
12 896 918 22
13 947 969 22
14 1025 1047 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup4833
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g937.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g224.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g5559.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g5633.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g9362.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g10814.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g10265.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g2229.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g5147.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g7607.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g1346.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g1780.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g712.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g3645.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g682.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g1573.t1 (this protein)
Aspergillus niger CBS 147346 Ani_SJS75_1|g5832.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g1501.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g737.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g4526.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g3751.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g3862.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g1397.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g5593.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g1573.t1
MTSQTTSEGLPLAANIFGFGVAALVGGRAFIAIVNRLRHRQLTLDTMFQSDGYEDRDGIATPESIKEFSDKPQRV
ALAIGTGIGVWLSLSEVVVFSIVSASTDDFTRWMRLGAWGTLALSTCAVWMEDECTLRFRHGIQTSIGCIAMMVL
LVADQYQCYKALDFSFLSWFFLLGQSCAALGACIAGTSLPRRPDVFHNGTVVDRKGSATFLDQLFFGWVGQLLSA
GQKDELEISHLPELEFNSRSPQLFHAFSQQCTASTSSLWKVLVLSHRKALSIQLLLTFLNGTMAFVPQFFILGIL
QRLENDPDDPWLWLFVLGLGASTIVSALIENWNLYVSSNLIAVRLQEQLSTVIYDKALRCRAVNNVGTDSQSAST
TSPSSQGTMNLVAVDAKKVADFSAVGFHLYEAPLKLIIAAISIGRLLGPQCLLVGGLVLFLVSAGNFYSVSQFSK
QQRGLLRSRDSKMGVINEVLQGIRQVKLSALEEKWENRINDSRGKELHSQWQVYKWELLMFVAYNVTPVAVSAAC
LGTYALLHGDMPASLAFTSVSLLGALETPLAVLPQILLNATGAQISLRRIERFLRTPDRDVDIAPADGVVLDQAT
ICWNENQYTKCFTLKDMSLTFPSGALSIITGPSGSGKSLVLAAILGECEFLQGCVRRSPSLAVAYVAQEPCLKDG
TIRDNILYGLPFQQERYRRVIFACSLDSDINSLRLKDDTQMDDQGSNLSGGQKWRISLARALYSDVEIIVLDDIF
SSIDSHTAQHLYQYALTGSLAEGRTRILATYHLELCLPRAEYVVALDANGLQYAGPRQNLRDMGIFKHMAQAAAG
VERASHIKKGSVVSNVPSSENWIGTLLPSEQEQLEDSAGQDGLVGEANTRDRKWRNRQRIFRLTDAKYRCLLVLF
LHLSYGGLAVGRGLWMMIWSNSTNKSRYTEDMNMKGAESTGVNITWFLSIYLLLSICSCIVAISRSFLAVRITLK
MSRKLFERFLSSILRAPLQWLDQIPAGNILNNFSADFSLIDSRLGYDLNYALGVVFDLLSIVLAASLVNVWLNLL
SACSLLLAFYYGQLFIKKIRAIKELESTMRSPVLHHLCATMDGIMTVRAYRQEETYRKEMFGKIDRHCRASWCLW
LLTRWIAVRASTIGAAFTTAASILVLSSNGITASTAGFAITFIMRYSGVMSQVIRQYANLEISLNSVERVSWSLD
IPAEKYESTDPMPESWPADGQLDVSDLTVCYSPDLPPVLSDLSFSIPPNTRVGVVGRTGAGKSSLAMALFRFLEA
QQGSIHVAGVDISTVPLRQLRTRLAIVPQDPILFSGTIRSNLDPFNEHSEQELLSALRRVHWTIPDADHDENHPG
SPLIKLDEDEEPRENPFNSLELQFQHPPSILNTAVTERGANFSQGQRQCLCLARAILRRPKILVLDEATSAIDKP
TDAVIQKSIRAEFGHNDSTLLVIAHRISTIVDFDRVLVLDAGRAIEYGTPRELIANRNGVFRSLVESSVERDELL
ETMHAAGP*
Coding >Ani_SJS72_1|g1573.t1
ATGACTTCCCAGACGACAAGCGAGGGGCTCCCCCTCGCGGCCAACATTTTCGGATTCGGTGTGGCGGCCCTGGTG
GGAGGAAGGGCCTTCATCGCCATCGTGAATCGACTGCGACATCGACAATTGACCCTCGACACAATGTTTCAATCG
GATGGGTATGAAGACCGCGATGGAATTGCAACACCAGAATCTATCAAAGAATTTTCCGACAAACCCCAACGCGTC
GCGCTTGCAATCGGAACCGGAATTGGTGTCTGGTTATCGTTATCGGAAGTTGTTGTGTTCAGCATTGTGTCTGCT
TCCACTGATGATTTCACACGATGGATGCGACTTGGAGCCTGGGGAACCCTGGCCCTCAGTACATGTGCGGTCTGG
ATGGAAGACGAATGCACGCTTCGGTTCCGACACGGCATTCAAACAAGCATCGGGTGCATCGCCATGATGGTCCTT
CTAGTTGCAGATCAGTACCAATGTTACAAGGCATTGGATTTTTCCTTCCTGTCTTGGTTCTTTCTGCTTGGCCAG
TCTTGCGCCGCTTTGGGCGCCTGCATTGCTGGAACGTCATTACCTCGTCGACCGGATGTTTTTCACAATGGGACT
GTGGTGGACCGCAAAGGATCAGCAACCTTCTTGGACCAGCTTTTCTTCGGATGGGTGGGTCAGCTGCTTTCTGCG
GGTCAGAAAGATGAGCTGGAGATCAGCCACCTGCCTGAGCTCGAGTTCAACAGCCGTTCACCTCAGCTATTTCAC
GCTTTTAGCCAACAATGCACGGCTTCTACCTCAAGCCTTTGGAAGGTCCTTGTCCTCAGTCATCGGAAAGCCCTA
TCCATTCAACTCCTTTTGACCTTCCTGAATGGGACCATGGCATTCGTGCCCCAGTTTTTTATCTTGGGAATCTTG
CAGCGTCTGGAAAACGACCCTGATGATCCTTGGCTATGGCTTTTTGTTCTTGGACTGGGCGCATCGACTATCGTG
TCCGCTCTTATTGAAAATTGGAACCTCTATGTCTCATCCAATCTGATTGCAGTGAGGCTGCAGGAACAGCTATCA
ACAGTGATCTATGACAAAGCGTTACGTTGTCGTGCAGTGAACAATGTCGGGACGGATTCGCAGAGTGCCAGTACC
ACCAGCCCATCTAGTCAGGGTACCATGAACTTGGTCGCTGTGGATGCAAAGAAAGTGGCTGACTTTTCAGCCGTT
GGCTTTCATCTTTACGAGGCACCACTGAAACTCATTATTGCGGCTATTTCGATTGGCCGGTTGCTTGGACCTCAG
TGCCTACTGGTCGGTGGCTTAGTACTTTTTCTTGTATCTGCTGGAAACTTTTACTCAGTCAGCCAGTTTTCGAAG
CAACAAAGAGGTCTTTTAAGGTCTCGTGACAGCAAGATGGGAGTCATCAACGAGGTTCTCCAGGGTATCCGCCAA
GTCAAATTATCCGCTCTGGAGGAAAAATGGGAAAACCGCATCAACGACTCAAGAGGGAAGGAGCTACACAGCCAG
TGGCAAGTTTATAAGTGGGAACTTCTCATGTTCGTTGCTTATAATGTCACCCCGGTTGCTGTTTCCGCCGCTTGC
TTAGGTACATATGCCCTTTTACATGGGGACATGCCGGCGTCTCTCGCTTTCACCTCGGTCTCGCTTCTTGGTGCA
CTTGAAACGCCTCTTGCAGTTCTCCCCCAAATCCTGCTTAATGCGACGGGGGCTCAAATTAGCCTGCGACGGATC
GAACGTTTCCTTCGAACTCCAGACAGGGATGTCGATATTGCGCCCGCTGATGGGGTTGTGCTGGATCAGGCCACA
ATTTGCTGGAACGAAAATCAATACACTAAATGCTTCACCTTGAAAGACATGTCTCTAACCTTCCCATCTGGCGCT
TTGAGTATCATTACGGGGCCATCTGGCTCCGGCAAAAGTCTCGTTCTTGCAGCAATCCTTGGTGAATGCGAGTTT
CTGCAAGGTTGTGTACGACGGTCCCCAAGCCTGGCGGTTGCCTACGTTGCTCAGGAGCCGTGCTTGAAAGATGGA
ACGATCAGGGACAACATTCTTTATGGCCTGCCGTTTCAGCAGGAGCGCTACCGCCGCGTTATTTTCGCCTGCTCC
CTTGACAGCGACATAAATAGTCTGAGGCTGAAAGATGACACTCAAATGGATGACCAAGGGAGCAATCTCAGTGGT
GGCCAGAAATGGCGTATCTCTCTTGCGCGCGCTCTCTATTCCGATGTCGAGATAATCGTACTGGATGATATTTTC
AGCTCCATTGATTCTCATACGGCGCAGCATCTATATCAGTATGCTCTGACGGGGAGTCTCGCCGAGGGGCGCACA
CGTATACTGGCCACTTATCACCTGGAACTGTGCTTACCAAGAGCTGAATACGTTGTTGCCCTTGACGCCAATGGA
CTGCAGTATGCTGGCCCCAGACAAAATCTGAGGGATATGGGCATATTCAAGCATATGGCCCAGGCTGCAGCAGGA
GTGGAGAGGGCTTCTCACATCAAGAAAGGCTCTGTGGTGTCGAATGTTCCGTCTTCAGAAAACTGGATCGGAACG
CTATTGCCCAGTGAGCAAGAGCAACTAGAAGACTCAGCAGGGCAAGATGGTTTGGTTGGTGAGGCCAATACACGA
GACCGTAAATGGCGAAATCGCCAGCGAATTTTCCGCTTGACTGACGCCAAGTATCGTTGCTTGCTTGTTTTGTTC
TTGCATCTGAGCTATGGCGGACTAGCAGTTGGCCGAGGTCTGTGGATGATGATCTGGAGTAACAGCACGAACAAG
AGCAGGTACACAGAAGACATGAATATGAAAGGAGCTGAGTCCACGGGAGTGAACATTACGTGGTTTCTATCTATC
TACCTATTATTGTCGATCTGTTCATGCATCGTCGCGATCAGTCGGAGCTTCTTGGCAGTGCGCATTACCTTAAAG
ATGTCAAGAAAGCTATTTGAAAGGTTTCTCTCTTCGATACTACGCGCTCCCCTGCAATGGCTCGACCAGATACCA
GCCGGCAACATTCTAAACAACTTTTCCGCCGACTTTAGCTTGATAGACTCGCGCCTTGGATATGATCTCAACTAC
GCACTGGGTGTTGTGTTTGATCTCCTATCCATCGTGTTGGCTGCCTCCCTGGTGAATGTCTGGCTGAATCTCCTC
TCCGCCTGTTCACTCTTACTGGCGTTTTACTACGGGCAATTATTTATTAAGAAAATCCGCGCCATCAAGGAACTC
GAAAGTACAATGCGAAGCCCGGTACTTCACCACCTGTGTGCAACCATGGACGGAATAATGACCGTTCGCGCCTAC
CGTCAAGAGGAGACCTACCGAAAGGAAATGTTTGGCAAGATTGACCGGCATTGCCGGGCATCCTGGTGTCTCTGG
CTGCTTACACGTTGGATCGCCGTCCGCGCAAGCACCATTGGCGCCGCTTTTACCACTGCGGCCTCTATACTCGTG
CTGTCTTCCAACGGCATCACGGCGTCGACTGCTGGATTTGCCATCACATTCATCATGCGGTATAGTGGCGTTATG
TCGCAGGTGATCAGGCAATACGCAAACCTCGAGATATCTCTTAACAGTGTTGAACGTGTTTCGTGGTCCCTCGAC
ATCCCTGCAGAGAAATATGAATCCACCGACCCGATGCCAGAGTCGTGGCCCGCGGACGGCCAACTGGACGTATCA
GACTTGACCGTCTGTTATTCGCCCGATTTGCCACCTGTTCTCTCCGATCTATCTTTTTCCATCCCGCCAAACACC
AGAGTCGGAGTGGTCGGTCGTACCGGTGCAGGCAAGTCCTCGTTGGCAATGGCCCTCTTCCGCTTCCTGGAAGCT
CAGCAAGGAAGTATTCATGTGGCGGGGGTGGACATTTCGACTGTTCCGCTTCGCCAGCTACGGACGCGCCTGGCA
ATCGTACCACAAGACCCGATCTTGTTCTCCGGCACGATACGGTCTAATCTCGATCCGTTTAACGAGCACTCAGAG
CAAGAACTCTTGTCTGCTTTGCGACGCGTGCACTGGACTATCCCTGATGCTGATCACGACGAAAACCATCCTGGA
TCGCCTTTGATAAAACTAGATGAGGATGAAGAACCCAGAGAAAACCCTTTTAACTCTCTGGAACTCCAATTCCAG
CACCCTCCAAGCATTCTAAACACTGCAGTCACCGAAAGAGGCGCGAACTTCTCCCAAGGTCAAAGACAGTGTCTC
TGCCTCGCCCGGGCCATCCTCCGCCGGCCCAAAATCCTTGTTCTAGACGAGGCAACCTCAGCCATCGACAAGCCC
ACAGACGCAGTAATCCAGAAATCCATCCGGGCTGAGTTTGGGCACAATGACTCTACACTATTAGTCATCGCCCAT
CGCATTAGCACTATCGTTGACTTTGATCGGGTGCTTGTGCTAGACGCCGGTCGGGCTATCGAGTACGGCACACCC
CGGGAACTGATAGCGAATCGGAATGGAGTCTTTCGCAGCCTAGTTGAGAGCAGCGTTGAGAGAGACGAGTTGTTG
GAGACTATGCATGCTGCCGGTCCGTGA
Transcript >Ani_SJS72_1|g1573.t1
ATGACTTCCCAGACGACAAGCGAGGGGCTCCCCCTCGCGGCCAACATTTTCGGATTCGGTGTGGCGGCCCTGGTG
GGAGGAAGGGCCTTCATCGCCATCGTGAATCGACTGCGACATCGACAATTGACCCTCGACACAATGTTTCAATCG
GATGGGTATGAAGACCGCGATGGAATTGCAACACCAGAATCTATCAAAGAATTTTCCGACAAACCCCAACGCGTC
GCGCTTGCAATCGGAACCGGAATTGGTGTCTGGTTATCGTTATCGGAAGTTGTTGTGTTCAGCATTGTGTCTGCT
TCCACTGATGATTTCACACGATGGATGCGACTTGGAGCCTGGGGAACCCTGGCCCTCAGTACATGTGCGGTCTGG
ATGGAAGACGAATGCACGCTTCGGTTCCGACACGGCATTCAAACAAGCATCGGGTGCATCGCCATGATGGTCCTT
CTAGTTGCAGATCAGTACCAATGTTACAAGGCATTGGATTTTTCCTTCCTGTCTTGGTTCTTTCTGCTTGGCCAG
TCTTGCGCCGCTTTGGGCGCCTGCATTGCTGGAACGTCATTACCTCGTCGACCGGATGTTTTTCACAATGGGACT
GTGGTGGACCGCAAAGGATCAGCAACCTTCTTGGACCAGCTTTTCTTCGGATGGGTGGGTCAGCTGCTTTCTGCG
GGTCAGAAAGATGAGCTGGAGATCAGCCACCTGCCTGAGCTCGAGTTCAACAGCCGTTCACCTCAGCTATTTCAC
GCTTTTAGCCAACAATGCACGGCTTCTACCTCAAGCCTTTGGAAGGTCCTTGTCCTCAGTCATCGGAAAGCCCTA
TCCATTCAACTCCTTTTGACCTTCCTGAATGGGACCATGGCATTCGTGCCCCAGTTTTTTATCTTGGGAATCTTG
CAGCGTCTGGAAAACGACCCTGATGATCCTTGGCTATGGCTTTTTGTTCTTGGACTGGGCGCATCGACTATCGTG
TCCGCTCTTATTGAAAATTGGAACCTCTATGTCTCATCCAATCTGATTGCAGTGAGGCTGCAGGAACAGCTATCA
ACAGTGATCTATGACAAAGCGTTACGTTGTCGTGCAGTGAACAATGTCGGGACGGATTCGCAGAGTGCCAGTACC
ACCAGCCCATCTAGTCAGGGTACCATGAACTTGGTCGCTGTGGATGCAAAGAAAGTGGCTGACTTTTCAGCCGTT
GGCTTTCATCTTTACGAGGCACCACTGAAACTCATTATTGCGGCTATTTCGATTGGCCGGTTGCTTGGACCTCAG
TGCCTACTGGTCGGTGGCTTAGTACTTTTTCTTGTATCTGCTGGAAACTTTTACTCAGTCAGCCAGTTTTCGAAG
CAACAAAGAGGTCTTTTAAGGTCTCGTGACAGCAAGATGGGAGTCATCAACGAGGTTCTCCAGGGTATCCGCCAA
GTCAAATTATCCGCTCTGGAGGAAAAATGGGAAAACCGCATCAACGACTCAAGAGGGAAGGAGCTACACAGCCAG
TGGCAAGTTTATAAGTGGGAACTTCTCATGTTCGTTGCTTATAATGTCACCCCGGTTGCTGTTTCCGCCGCTTGC
TTAGGTACATATGCCCTTTTACATGGGGACATGCCGGCGTCTCTCGCTTTCACCTCGGTCTCGCTTCTTGGTGCA
CTTGAAACGCCTCTTGCAGTTCTCCCCCAAATCCTGCTTAATGCGACGGGGGCTCAAATTAGCCTGCGACGGATC
GAACGTTTCCTTCGAACTCCAGACAGGGATGTCGATATTGCGCCCGCTGATGGGGTTGTGCTGGATCAGGCCACA
ATTTGCTGGAACGAAAATCAATACACTAAATGCTTCACCTTGAAAGACATGTCTCTAACCTTCCCATCTGGCGCT
TTGAGTATCATTACGGGGCCATCTGGCTCCGGCAAAAGTCTCGTTCTTGCAGCAATCCTTGGTGAATGCGAGTTT
CTGCAAGGTTGTGTACGACGGTCCCCAAGCCTGGCGGTTGCCTACGTTGCTCAGGAGCCGTGCTTGAAAGATGGA
ACGATCAGGGACAACATTCTTTATGGCCTGCCGTTTCAGCAGGAGCGCTACCGCCGCGTTATTTTCGCCTGCTCC
CTTGACAGCGACATAAATAGTCTGAGGCTGAAAGATGACACTCAAATGGATGACCAAGGGAGCAATCTCAGTGGT
GGCCAGAAATGGCGTATCTCTCTTGCGCGCGCTCTCTATTCCGATGTCGAGATAATCGTACTGGATGATATTTTC
AGCTCCATTGATTCTCATACGGCGCAGCATCTATATCAGTATGCTCTGACGGGGAGTCTCGCCGAGGGGCGCACA
CGTATACTGGCCACTTATCACCTGGAACTGTGCTTACCAAGAGCTGAATACGTTGTTGCCCTTGACGCCAATGGA
CTGCAGTATGCTGGCCCCAGACAAAATCTGAGGGATATGGGCATATTCAAGCATATGGCCCAGGCTGCAGCAGGA
GTGGAGAGGGCTTCTCACATCAAGAAAGGCTCTGTGGTGTCGAATGTTCCGTCTTCAGAAAACTGGATCGGAACG
CTATTGCCCAGTGAGCAAGAGCAACTAGAAGACTCAGCAGGGCAAGATGGTTTGGTTGGTGAGGCCAATACACGA
GACCGTAAATGGCGAAATCGCCAGCGAATTTTCCGCTTGACTGACGCCAAGTATCGTTGCTTGCTTGTTTTGTTC
TTGCATCTGAGCTATGGCGGACTAGCAGTTGGCCGAGGTCTGTGGATGATGATCTGGAGTAACAGCACGAACAAG
AGCAGGTACACAGAAGACATGAATATGAAAGGAGCTGAGTCCACGGGAGTGAACATTACGTGGTTTCTATCTATC
TACCTATTATTGTCGATCTGTTCATGCATCGTCGCGATCAGTCGGAGCTTCTTGGCAGTGCGCATTACCTTAAAG
ATGTCAAGAAAGCTATTTGAAAGGTTTCTCTCTTCGATACTACGCGCTCCCCTGCAATGGCTCGACCAGATACCA
GCCGGCAACATTCTAAACAACTTTTCCGCCGACTTTAGCTTGATAGACTCGCGCCTTGGATATGATCTCAACTAC
GCACTGGGTGTTGTGTTTGATCTCCTATCCATCGTGTTGGCTGCCTCCCTGGTGAATGTCTGGCTGAATCTCCTC
TCCGCCTGTTCACTCTTACTGGCGTTTTACTACGGGCAATTATTTATTAAGAAAATCCGCGCCATCAAGGAACTC
GAAAGTACAATGCGAAGCCCGGTACTTCACCACCTGTGTGCAACCATGGACGGAATAATGACCGTTCGCGCCTAC
CGTCAAGAGGAGACCTACCGAAAGGAAATGTTTGGCAAGATTGACCGGCATTGCCGGGCATCCTGGTGTCTCTGG
CTGCTTACACGTTGGATCGCCGTCCGCGCAAGCACCATTGGCGCCGCTTTTACCACTGCGGCCTCTATACTCGTG
CTGTCTTCCAACGGCATCACGGCGTCGACTGCTGGATTTGCCATCACATTCATCATGCGGTATAGTGGCGTTATG
TCGCAGGTGATCAGGCAATACGCAAACCTCGAGATATCTCTTAACAGTGTTGAACGTGTTTCGTGGTCCCTCGAC
ATCCCTGCAGAGAAATATGAATCCACCGACCCGATGCCAGAGTCGTGGCCCGCGGACGGCCAACTGGACGTATCA
GACTTGACCGTCTGTTATTCGCCCGATTTGCCACCTGTTCTCTCCGATCTATCTTTTTCCATCCCGCCAAACACC
AGAGTCGGAGTGGTCGGTCGTACCGGTGCAGGCAAGTCCTCGTTGGCAATGGCCCTCTTCCGCTTCCTGGAAGCT
CAGCAAGGAAGTATTCATGTGGCGGGGGTGGACATTTCGACTGTTCCGCTTCGCCAGCTACGGACGCGCCTGGCA
ATCGTACCACAAGACCCGATCTTGTTCTCCGGCACGATACGGTCTAATCTCGATCCGTTTAACGAGCACTCAGAG
CAAGAACTCTTGTCTGCTTTGCGACGCGTGCACTGGACTATCCCTGATGCTGATCACGACGAAAACCATCCTGGA
TCGCCTTTGATAAAACTAGATGAGGATGAAGAACCCAGAGAAAACCCTTTTAACTCTCTGGAACTCCAATTCCAG
CACCCTCCAAGCATTCTAAACACTGCAGTCACCGAAAGAGGCGCGAACTTCTCCCAAGGTCAAAGACAGTGTCTC
TGCCTCGCCCGGGCCATCCTCCGCCGGCCCAAAATCCTTGTTCTAGACGAGGCAACCTCAGCCATCGACAAGCCC
ACAGACGCAGTAATCCAGAAATCCATCCGGGCTGAGTTTGGGCACAATGACTCTACACTATTAGTCATCGCCCAT
CGCATTAGCACTATCGTTGACTTTGATCGGGTGCTTGTGCTAGACGCCGGTCGGGCTATCGAGTACGGCACACCC
CGGGAACTGATAGCGAATCGGAATGGAGTCTTTCGCAGCCTAGTTGAGAGCAGCGTTGAGAGAGACGAGTTGTTG
GAGACTATGCATGCTGCCGGTCCGTGA
Gene >Ani_SJS72_1|g1573.t1
ATGACTTCCCAGACGACAAGCGAGGGGCTCCCCCTCGCGGCCAACATTTTCGGATTCGGTGTGGCGGCCCTGGTG
GGAGGAAGGGCCTTCATCGCCATCGTGAATCGACTGCGACATCGACAATTGACCCTCGACACAATGTTTCAATCG
GATGGGTATGAAGACCGCGATGGAATTGCAACACCAGAATCTATCAAAGAATTTTCCGACAAACCCCAACGCGTC
GCGCTTGCAATCGGAACCGGAATTGGTGTCTGGTTATCGTTATCGGAAGTTGTTGTGTTCAGCATTGTGTCTGCT
TCCACTGATGATTTCACACGATGGATGCGACTTGGAGCCTGGGGAACCCTGGCCCTCAGTACATGTGCGGTCTGG
ATGGAAGACGAATGCACGCTTCGGTTCCGACACGGCATTCAAACAAGCATCGGGTGCATCGCCATGATGGTCCTT
CTAGTTGCAGATCAGTACCAATGTTACAAGGCATTGGATTTTTCCTTCCTGTCTTGGTTCTTTCTGCTTGGCCAG
TCTTGCGCCGCTTTGGGCGCCTGCATTGCTGGAACGTCATTACCTCGTCGACCGGATGTTTTTCACAATGGGACT
GTGGTGGACCGCAAAGGATCAGCAACCTTCTTGGACCAGCTTTTCTTCGGATGGGTGGGTCAGCTGCTTTCTGCG
GGTCAGAAAGATGAGCTGGAGATCAGCCACCTGCCTGAGCTCGAGTTCAACAGCCGTTCACCTCAGCTATTTCAC
GCTTTTAGCCAACAATGCACGGCTTCTACCTCAAGCCTTTGGAAGGTCCTTGTCCTCAGTCATCGGAAAGCCCTA
TCCATTCAACTCCTTTTGACCTTCCTGAATGGGACCATGGCATTCGTGCCCCAGTTTTTTATCTTGGGAATCTTG
CAGCGTCTGGAAAACGACCCTGATGATCCTTGGCTATGGCTTTTTGTTCTTGGACTGGGCGCATCGACTATCGTG
TCCGCTCTTATTGAAAATTGGAACCTCTATGTCTCATCCAATCTGATTGCAGTGAGGCTGCAGGAACAGCTATCA
ACAGTGATCTATGACAAAGCGTTACGTTGTCGTGCAGTGAACAATGTCGGGACGGATTCGCAGAGTGCCAGTACC
ACCAGCCCATCTAGTCAGGGTACCATGAACTTGGTCGCTGTGGATGCAAAGAAAGTGGCTGACTTTTCAGCCGTT
GGCTTTCATCTTTACGAGGCACCACTGAAACTCATTATTGCGGCTATTTCGATTGGCCGGTTGCTTGGACCTCAG
TGCCTACTGGTCGGTGGCTTAGTACTTTTTCTTGTATCTGCTGGAAACTTTTACTCAGTCAGCCAGTTTTCGAAG
CAACAAAGAGGTCTTTTAAGGTCTCGTGACAGCAAGATGGGAGTCATCAACGAGGTTCTCCAGGGTATCCGCCAA
GTCAAATTATCCGCTCTGGAGGAAAAATGGGAAAACCGCATCAACGACTCAAGAGGGAAGGAGCTACACAGCCAG
TGGCAAGTTTATAAGTGGGAACTTCTCATGTTCGTTGCTTATAATGTCACCCCGGTTGCTGTTTCCGCCGCTTGC
TTAGGTACATATGCCCTTTTACATGGGGACATGCCGGCGTCTCTCGCTTTCACCTCGGTCTCGCTTCTTGGTGCA
CTTGAAACGCCTCTTGCAGTTCTCCCCCAAATCCTGCTTAATGCGACGGGGGCTCAAATTAGCCTGCGACGGATC
GAACGTTTCCTTCGAACTCCAGACAGGGATGTCGATATTGCGCCCGCTGATGGGGTTGTGCTGGATCAGGCCACA
ATTTGCTGGAACGAAAATCAATACACTAAATGCTTCACCTTGAAAGACATGTCTCTAACCTTCCCATCTGGCGCT
TTGAGTATCATTACGGGGCCATCTGGCTCCGGCAAAAGTCTCGTTCTTGCAGCAATCCTTGGTGAATGCGAGTTT
CTGCAAGGTTGTGTACGACGGTCCCCAAGCCTGGCGGTTGCCTACGTTGCTCAGGAGCCGTGCTTGAAAGATGGA
ACGATCAGGGACAACATTCTTTATGGCCTGCCGTTTCAGCAGGAGCGCTACCGCCGCGTTATTTTCGCCTGCTCC
CTTGACAGCGACATAAATAGTCTGAGGCTGAAAGATGACACTCAAATGGATGACCAAGGGAGCAATCTCAGTGGT
GGCCAGAAATGGCGTATCTCTCTTGCGCGCGCTCTCTATTCCGATGTCGAGATAATCGTACTGGATGATATTTTC
AGCTCCATTGATTCTCATACGGCGCAGCATCTATATCAGTATGCTCTGACGGGGAGTCTCGCCGAGGGGCGCACA
CGTATACTGGCCACTTATCACCTGGAACTGTGCTTACCAAGAGCTGAATACGTTGTTGCCCTTGACGCCAATGGA
CTGCAGTATGCTGGCCCCAGACAAAATCTGAGGGATATGGGCATATTCAAGCATATGGCCCAGGCTGCAGCAGGA
GTGGAGAGGGCTTCTCACATCAAGAAAGGCTCTGTGGTGTCGAATGTTCCGTCTTCAGAAAACTGGATCGGAACG
CTATTGCCCAGTGAGCAAGAGCAACTAGAAGACTCAGCAGGGCAAGATGGTTTGGTTGGTGAGGCCAATACACGA
GACCGTAAATGGCGAAATCGCCAGCGAATTTTCCGCTTGACTGACGCCAAGTATCGTTGCTTGCTTGTTTTGTTC
TTGCATCTGAGCTATGGCGGACTAGCAGTTGGCCGAGGTCTGTGGATGATGATCTGGAGTAACAGCACGAACAAG
AGCAGGTACACAGAAGACATGAATATGAAAGGAGCTGAGTCCACGGGAGTGAACATTACGTGGTTTCTATCTATC
TACCTATTATTGTCGATCTGTTCATGCATCGTCGCGATCAGTCGGAGCTTCTTGGCAGTGCGCATTACCTTAAAG
ATGTCAAGAAAGCTATTTGAAAGGTTTCTCTCTTCGATACTACGCGCTCCCCTGCAATGGCTCGACCAGATACCA
GCCGGCAACATTCTAAACAACTTTTCCGCCGACTTTAGCTTGATAGACTCGCGCCTTGGATATGATCTCAACTAC
GCACTGGGTGTTGTGTTTGATCTCCTATCCATCGTGTTGGCTGCCTCCCTGGTGAATGTCTGGCTGAATCTCCTC
TCCGCCTGTTCACTCTTACTGGCGTTTTACTACGGGCAATTATTTATTAAGAAAATCCGCGCCATCAAGGAACTC
GAAAGTACAATGCGAAGCCCGGTACTTCACCACCTGTGTGCAACCATGGACGGAATAATGACCGTTCGCGCCTAC
CGTCAAGAGGAGACCTACCGAAAGGAAATGTTTGGCAAGATTGACCGGCATTGCCGGGCATCCTGGTGTCTCTGG
CTGCTTACACGTTGGATCGCCGTCCGCGCAAGCACCATTGGCGCCGCTTTTACCACTGCGGCCTCTATACTCGTG
CTGTCTTCCAACGGCATCACGGCGTCGACTGCTGGATTTGCCATCACATTCATCATGCGGTATAGTGGCGTTATG
TCGCAGGTGATCAGGCAATACGCAAACCTCGAGATATCTCTTAACAGTGTTGAACGTGTTTCGTGGTCCCTCGAC
ATCCCTGCAGAGAAATATGAATCCACCGACCCGATGCCAGAGTCGTGGCCCGCGGACGGCCAACTGGACGTATCA
GACTTGACCGTCTGTTATTCGCCCGATTTGCCACCTGTTCTCTCCGATCTATCTTTTTCCATCCCGCCAAACACC
AGAGTCGGAGTGGTCGGTCGTACCGGTGCAGGCAAGTCCTCGTTGGCAATGGCCCTCTTCCGCTTCCTGGAAGCT
CAGCAAGGAAGTATTCATGTGGCGGGGGTGGACATTTCGACTGTTCCGCTTCGCCAGCTACGGACGCGCCTGGCA
ATCGTACCACAAGACCCGATCTTGTTCTCCGGCACGATACGGTCTAATCTCGATCCGTTTAACGAGCACTCAGAG
CAAGAACTCTTGTCTGCTTTGCGACGCGTGCACTGGACTATCCCTGATGCTGATCACGACGAAAACCATCCTGGA
TCGCCTTTGATAAAACTAGATGAGGATGAAGAACCCAGAGAAAACCCTTTTAACTCTCTGGAACTCCAATTCCAG
CACCCTCCAAGCATTCTAAACACTGCAGTCACCGAAAGAGGCGCGAACTTCTCCCAAGGTCAAAGACAGTGTCTC
TGCCTCGCCCGGGCCATCCTCCGCCGGCCCAAAATCCTTGTTCTAGACGAGGCAACCTCAGCCATCGACAAGCCC
ACAGACGCAGTAATCCAGAAATCCATCCGGGCTGAGTTTGGGCACAATGACTCTACACTATTAGTCATCGCCCAT
CGCATTAGCACTATCGTTGACTTTGATCGGGTGCTTGTGCTAGACGCCGGTCGGGCTATCGAGTACGGCACACCC
CGGGAACTGATAGCGAATCGGAATGGAGTCTTTCGCAGCCTAGTTGAGAGCAGCGTTGAGAGAGACGAGTTGTTG
GAGACTATGCATGCTGCCGGTCCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail