Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g113.t1
Gene name
Locationscaffold_001:332562..334487
Strand+
Gene length (bp)1925
Transcript length (bp)1518
Coding sequence length (bp)1518
Protein length (aa) 506

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.6E-30 70 428

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 105 124 19
2 131 153 22
3 157 179 22
4 192 214 22
5 224 246 22
6 298 320 22
7 324 346 22
8 353 373 20
9 378 400 22
10 413 435 22
11 445 467 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g113.t1
MAQVDEKPALNNSSRGVVDTEKATTVHGLPEESQLDFLDDPDEGLSEEEKAKIDRALLWKLDLRLIPWLSLLYLI
SFLDRTNVGNAKLAGLQGDLHMTNSQYNDSLTIFFVSYAIFEPITNVLLKRWRPSVFIPIIMVVWGICMTCMGLV
HNFSRIMAVRWFLGLAEAGLFPGVGYFLSCWYKRSEFGVRMAIFFSAAALAGSFGGLLAAAIALMDGIGGKAGWS
WIFILEGLLTIVIGVLSVWMVYDFPDQARFLSEPDRKRVLRRLAADKQASAAYEKFEMTYFWSSLKDWKTYLNAI
IYMGSCMPLYAFSLFTPTIINELAQLLSVPPYAAAAIVTVAVGFIADRTGQRGICNIVVSILGIAGFSLLLGASS
AGARYAGVFLGAMGIYPAISNTISWASNNAEGVYKRGVTLGIVIGWGNLNGVVSSNIYRGGDAPQFYPGHGAVLA
YLVLFLFGGSVVQYVLLRRENAKRRRGDRDHWITGLERQEIEKLGDKRPDFIYTL*
Coding >Ani_SJS72_1|g113.t1
ATGGCGCAGGTCGACGAGAAACCAGCGTTAAACAATTCCTCACGGGGCGTGGTGGATACAGAAAAGGCTACTACT
GTTCACGGCTTACCAGAGGAGTCGCAACTGGACTTTCTTGATGATCCGGATGAAGGTTTGAGTGAGGAGGAAAAG
GCGAAGATCGATCGTGCATTACTGTGGAAACTTGATTTGCGGCTTATCCCGTGGTTGAGTCTGCTGTACCTGATT
TCCTTTTTGGACAGGACGAATGTCGGCAATGCAAAGCTCGCTGGTCTCCAAGGGGACTTGCATATGACCAACTCG
CAGTACAACGACTCCTTGACCATTTTCTTCGTGTCATACGCGATCTTCGAACCTATCACCAATGTTCTCCTCAAG
CGCTGGCGGCCTAGCGTGTTTATTCCGATTATAATGGTAGTATGGGGCATATGCATGACTTGTATGGGACTCGTA
CACAACTTCTCTAGGATCATGGCGGTGCGATGGTTCCTTGGTCTGGCGGAAGCCGGTCTCTTTCCTGGCGTCGGA
TACTTCTTATCCTGCTGGTACAAAAGATCCGAATTCGGCGTTCGCATGGCCATCTTCTTCTCCGCCGCTGCTCTT
GCGGGGTCGTTCGGCGGATTGCTCGCGGCTGCGATTGCCCTGATGGATGGCATTGGAGGCAAGGCGGGCTGGTCT
TGGATCTTCATTCTTGAGGGTCTGCTGACGATCGTCATCGGCGTGCTGTCTGTATGGATGGTCTACGACTTTCCG
GACCAGGCCAGATTCTTATCCGAACCGGATCGCAAGCGTGTACTGCGTCGTCTGGCAGCTGACAAGCAAGCCAGT
GCTGCGTACGAGAAGTTTGAGATGACGTATTTCTGGAGCAGTCTGAAGGACTGGAAGACCTATCTCAATGCGATC
ATCTACATGGGTTCATGCATGCCGCTATATGCATTCTCCCTATTTACCCCCACTATCATCAATGAGCTAGCGCAG
CTTCTCAGTGTCCCGCCTTATGCCGCGGCGGCTATCGTCACTGTGGCAGTCGGGTTCATCGCAGATCGGACCGGC
CAACGTGGCATCTGCAACATTGTGGTGTCAATCCTCGGTATCGCCGGGTTCTCCTTGCTTCTTGGGGCGAGTTCT
GCAGGGGCACGATATGCAGGGGTGTTCCTGGGCGCCATGGGTATCTACCCAGCGATCTCGAACACCATTTCCTGG
GCCAGTAACAACGCAGAGGGTGTGTACAAGCGCGGTGTCACGCTGGGTATTGTCATTGGCTGGGGCAACCTGAAC
GGCGTCGTGTCGTCCAACATCTACCGCGGCGGAGACGCGCCTCAGTTCTATCCGGGACACGGGGCGGTGCTGGCA
TATTTAGTGCTGTTTCTGTTTGGCGGATCAGTAGTGCAGTATGTCCTTCTCCGACGGGAGAACGCGAAACGTCGT
CGGGGCGATCGAGACCACTGGATAACAGGACTGGAGAGACAGGAGATCGAGAAGCTTGGAGACAAGCGGCCAGAC
TTTATATACACGCTGTAG
Transcript >Ani_SJS72_1|g113.t1
ATGGCGCAGGTCGACGAGAAACCAGCGTTAAACAATTCCTCACGGGGCGTGGTGGATACAGAAAAGGCTACTACT
GTTCACGGCTTACCAGAGGAGTCGCAACTGGACTTTCTTGATGATCCGGATGAAGGTTTGAGTGAGGAGGAAAAG
GCGAAGATCGATCGTGCATTACTGTGGAAACTTGATTTGCGGCTTATCCCGTGGTTGAGTCTGCTGTACCTGATT
TCCTTTTTGGACAGGACGAATGTCGGCAATGCAAAGCTCGCTGGTCTCCAAGGGGACTTGCATATGACCAACTCG
CAGTACAACGACTCCTTGACCATTTTCTTCGTGTCATACGCGATCTTCGAACCTATCACCAATGTTCTCCTCAAG
CGCTGGCGGCCTAGCGTGTTTATTCCGATTATAATGGTAGTATGGGGCATATGCATGACTTGTATGGGACTCGTA
CACAACTTCTCTAGGATCATGGCGGTGCGATGGTTCCTTGGTCTGGCGGAAGCCGGTCTCTTTCCTGGCGTCGGA
TACTTCTTATCCTGCTGGTACAAAAGATCCGAATTCGGCGTTCGCATGGCCATCTTCTTCTCCGCCGCTGCTCTT
GCGGGGTCGTTCGGCGGATTGCTCGCGGCTGCGATTGCCCTGATGGATGGCATTGGAGGCAAGGCGGGCTGGTCT
TGGATCTTCATTCTTGAGGGTCTGCTGACGATCGTCATCGGCGTGCTGTCTGTATGGATGGTCTACGACTTTCCG
GACCAGGCCAGATTCTTATCCGAACCGGATCGCAAGCGTGTACTGCGTCGTCTGGCAGCTGACAAGCAAGCCAGT
GCTGCGTACGAGAAGTTTGAGATGACGTATTTCTGGAGCAGTCTGAAGGACTGGAAGACCTATCTCAATGCGATC
ATCTACATGGGTTCATGCATGCCGCTATATGCATTCTCCCTATTTACCCCCACTATCATCAATGAGCTAGCGCAG
CTTCTCAGTGTCCCGCCTTATGCCGCGGCGGCTATCGTCACTGTGGCAGTCGGGTTCATCGCAGATCGGACCGGC
CAACGTGGCATCTGCAACATTGTGGTGTCAATCCTCGGTATCGCCGGGTTCTCCTTGCTTCTTGGGGCGAGTTCT
GCAGGGGCACGATATGCAGGGGTGTTCCTGGGCGCCATGGGTATCTACCCAGCGATCTCGAACACCATTTCCTGG
GCCAGTAACAACGCAGAGGGTGTGTACAAGCGCGGTGTCACGCTGGGTATTGTCATTGGCTGGGGCAACCTGAAC
GGCGTCGTGTCGTCCAACATCTACCGCGGCGGAGACGCGCCTCAGTTCTATCCGGGACACGGGGCGGTGCTGGCA
TATTTAGTGCTGTTTCTGTTTGGCGGATCAGTAGTGCAGTATGTCCTTCTCCGACGGGAGAACGCGAAACGTCGT
CGGGGCGATCGAGACCACTGGATAACAGGACTGGAGAGACAGGAGATCGAGAAGCTTGGAGACAAGCGGCCAGAC
TTTATATACACGCTGTAG
Gene >Ani_SJS72_1|g113.t1
ATGGCGCAGGTCGACGAGAAACCAGCGTTAAACAATTCCTCACGGGGCGTGGTGGATACAGAAAAGGCTACTACT
GTTCACGGCTTACCAGAGGAGTCGCAACTGGACTTTCTTGATGATCCGGATGAAGGTTTGAGTGAGGAGGAAAAG
GCGAAGATCGTGAGTAACCTCCCCGGATCAACACCAACAGGGATGATGAGCTGGACTAATGCAATTGCCAGGATC
GTGCATTACTGTGGAAACTTGATTTGCGGCTTATCCCGTGGTTGAGTCTGCTGTACCTGATTTCCTTTTTGGACA
GGTGTGCACAGTTACCCCAATGATCGTCGTAGGAAATTAATCGTGGCTTAAATAGGACGAATGTCGGCAATGCAA
AGCTCGCTGGTCTCCAAGGGGACTTGCATATGACCAACTCGCAGTACAACGACTCCTTGACCATTTTCTTCGTGT
CATACGCGATCTTCGAACCTATCACCAATGTTCTCCTCAAGCGCTGGCGGCCTAGCGTGTTTATTCCGATTATAA
TGGTAGTATGGGTATGGATAATAAAGTCTTATGCAGGTTGACTTGCGCTGATTTTGGGACAGGGCATATGCATGA
CTTGTATGGGACTCGTACACAACTTCTCTAGGATCATGGCGGTGAGTGTCTGCATACATATACTATCTTCAAATA
AAGGAATTCGCGCGGCGCAATTGATATCCCTGCTGACGGTAGTAGGTGCGATGGTTCCTTGGTCTGGCGGAAGCC
GGTCTCTTTCCTGGCGTCGGATACTTCTTATCCTGCTGGTACAAAAGATCCGAATTCGGCGTTCGCATGGCCATC
TTCTTCTCCGCCGCTGCTCTTGCGGGGTCGTTCGGCGGATTGCTCGCGGCTGCGATTGCCCTGATGGATGGCATT
GGAGGCAAGGCGGGCTGGTCTTGGATCTTCATTCTTGAGGGTCTGCTGACGATCGTCATCGGCGTGCTGTCTGTA
TGGATGGTCTACGACTTTCCGGACCAGGCCAGATTCTTATCCGAACCGGATCGCAAGCGTGTACTGCGTCGTCTG
GCAGCTGACAAGCAAGCCAGTGCTGCGTACGAGAAGTTTGAGATGACGTATTTCTGGAGCAGTCTGAAGGACTGG
AAGACCTATCTCAATGCGATCATCTACATGGGTTCATGCATGCCGCTATATGCATTCTCCCTATTTACCCCCACT
ATCATCAATGAGCTAGTATGTCCTCCACAACCTGAGCATATTGCACAGCACTAACAATAGATAGGGTTTGTTTTG
ATACTCCTGTGATTCGGTAGGGATCTAACCGGCGCAGGCTATACCGCGATTCAGGCGCAGCTTCTCAGTGTCCCG
CCTTATGCCGCGGCGGCTATCGTCACTGTGGCAGTCGGGTTCATCGCAGATCGGACCGGCCAACGTGGCATCTGC
AACATTGTGGTGTCAATCCTCGGTATCGCCGGGTTCTCCTTGCTTCTTGGGGCGAGTTCTGCAGGGGCACGATAT
GCAGGGGTGTTCCTGGGCGCCATGGGTATCTACCCAGCGATCTCGAACACCATTTCCTGGGCCAGTAACAACGCA
GAGGGTATGCATCTCTATTGAATAGTGGATAACCATGGCTGACTGTGGCAGGTGTGTACAAGCGCGGTGTCACGC
TGGGTATTGTCATTGGCTGGGGCAACCTGAACGGCGTCGTGTCGTCCAACATCTACCGCGGCGGAGACGCGCCTC
AGTTCTATCCGGGACACGGGGCGGTGCTGGCATATTTAGTGCTGTTTCTGTTTGGCGGATCAGTAGTGCAGTATG
TCCTTCTCCGACGGGAGAACGCGAAACGTCGTCGGGGCGATCGAGACCACTGGATAACAGGACTGGAGAGACAGG
AGATCGAGAAGCTTGGAGACAAGCGGCCAGACTTTATATACACGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail