Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g11157.t1
Gene name
Locationscaffold_204:5684..6518
Strand+
Gene length (bp)834
Transcript length (bp)834
Coding sequence length (bp)834
Protein length (aa) 278

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13847 Methyltransf_31 Methyltransferase domain 8.9E-21 40 153
PF13649 Methyltransf_25 Methyltransferase domain 5.5E-20 44 148
PF08241 Methyltransf_11 Methyltransferase domain 3.2E-17 45 151
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 5.0E-17 25 151
PF13489 Methyltransf_23 Methyltransferase domain 1.3E-13 26 201
PF08242 Methyltransf_12 Methyltransferase domain 7.5E-13 45 150
PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 1.3E-06 39 158
PF01728 FtsJ FtsJ-like methyltransferase 1.9E-05 40 126

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0032259 methylation Yes
GO:0003824 catalytic activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g11157.t1
MSSSQTSIIQSIYDERSPNYDTSHHGALAEAYIRTAAPREGESVLDLACGTGLVSFLAEQAVGKPGLVVGVDISP
GMLDVARHKAQQTGSNVTFLQHDISHLSGVGLESMLPPGEEGFDLITCAAALVLLPDPGRAVRGWMRWLKPGGRI
VTDVAARDVHVPSRIFKRISGDLGMGLVWDESWVQGEWSLRELLEGAGLVVKTVFLTESFQDRVYSVADAGEVFE
RAVSSPMFRNFGDSGVRDEAKRLFVKRFAEEAGAEGVLVDEAKMYLAVAYKL*
Coding >Ani_SJS72_1|g11157.t1
ATGTCCTCGTCCCAAACATCCATTATCCAATCTATCTACGACGAGCGCAGCCCCAACTACGACACCTCCCACCAC
GGCGCCCTAGCAGAAGCATACATCCGCACCGCAGCACCCCGCGAAGGCGAATCCGTGCTCGACCTCGCCTGCGGC
ACAGGACTCGTATCCTTTCTTGCTGAGCAAGCCGTCGGCAAACCCGGCCTCGTTGTCGGAGTCGACATCAGTCCC
GGCATGCTGGATGTAGCGCGTCACAAGGCCCAGCAGACTGGTTCAAATGTGACGTTCCTTCAACATGATATCTCT
CACTTATCGGGTGTCGGACTAGAGAGTATGCTTCCTCCCGGAGAGGAGGGCTTCGATCTGATTACTTGTGCTGCG
GCGTTGGTGTTATTGCCTGACCCCGGGAGGGCGGTTAGGGGCTGGATGCGGTGGTTGAAGCCTGGTGGGAGGATC
GTGACGGATGTGGCGGCGAGAGATGTTCATGTCCCTAGTCGGATCTTTAAGAGAATCAGTGGTGATTTGGGGATG
GGGTTGGTGTGGGATGAGAGTTGGGTACAAGGGGAATGGTCTTTGAGGGAGCTTCTAGAGGGGGCTGGGCTGGTG
GTGAAGACGGTTTTCTTGACGGAGTCGTTTCAGGATCGTGTGTATAGTGTTGCTGATGCTGGAGAGGTGTTTGAA
AGGGCTGTTTCTAGTCCGATGTTTCGGAATTTTGGTGATTCAGGGGTGAGGGATGAGGCGAAGAGGTTGTTTGTC
AAGAGGTTTGCTGAGGAGGCGGGTGCGGAGGGGGTGTTGGTCGATGAGGCGAAGATGTATCTGGCTGTCGCGTAT
AAATTGTAG
Transcript >Ani_SJS72_1|g11157.t1
ATGTCCTCGTCCCAAACATCCATTATCCAATCTATCTACGACGAGCGCAGCCCCAACTACGACACCTCCCACCAC
GGCGCCCTAGCAGAAGCATACATCCGCACCGCAGCACCCCGCGAAGGCGAATCCGTGCTCGACCTCGCCTGCGGC
ACAGGACTCGTATCCTTTCTTGCTGAGCAAGCCGTCGGCAAACCCGGCCTCGTTGTCGGAGTCGACATCAGTCCC
GGCATGCTGGATGTAGCGCGTCACAAGGCCCAGCAGACTGGTTCAAATGTGACGTTCCTTCAACATGATATCTCT
CACTTATCGGGTGTCGGACTAGAGAGTATGCTTCCTCCCGGAGAGGAGGGCTTCGATCTGATTACTTGTGCTGCG
GCGTTGGTGTTATTGCCTGACCCCGGGAGGGCGGTTAGGGGCTGGATGCGGTGGTTGAAGCCTGGTGGGAGGATC
GTGACGGATGTGGCGGCGAGAGATGTTCATGTCCCTAGTCGGATCTTTAAGAGAATCAGTGGTGATTTGGGGATG
GGGTTGGTGTGGGATGAGAGTTGGGTACAAGGGGAATGGTCTTTGAGGGAGCTTCTAGAGGGGGCTGGGCTGGTG
GTGAAGACGGTTTTCTTGACGGAGTCGTTTCAGGATCGTGTGTATAGTGTTGCTGATGCTGGAGAGGTGTTTGAA
AGGGCTGTTTCTAGTCCGATGTTTCGGAATTTTGGTGATTCAGGGGTGAGGGATGAGGCGAAGAGGTTGTTTGTC
AAGAGGTTTGCTGAGGAGGCGGGTGCGGAGGGGGTGTTGGTCGATGAGGCGAAGATGTATCTGGCTGTCGCGTAT
AAATTGTAG
Gene >Ani_SJS72_1|g11157.t1
ATGTCCTCGTCCCAAACATCCATTATCCAATCTATCTACGACGAGCGCAGCCCCAACTACGACACCTCCCACCAC
GGCGCCCTAGCAGAAGCATACATCCGCACCGCAGCACCCCGCGAAGGCGAATCCGTGCTCGACCTCGCCTGCGGC
ACAGGACTCGTATCCTTTCTTGCTGAGCAAGCCGTCGGCAAACCCGGCCTCGTTGTCGGAGTCGACATCAGTCCC
GGCATGCTGGATGTAGCGCGTCACAAGGCCCAGCAGACTGGTTCAAATGTGACGTTCCTTCAACATGATATCTCT
CACTTATCGGGTGTCGGACTAGAGAGTATGCTTCCTCCCGGAGAGGAGGGCTTCGATCTGATTACTTGTGCTGCG
GCGTTGGTGTTATTGCCTGACCCCGGGAGGGCGGTTAGGGGCTGGATGCGGTGGTTGAAGCCTGGTGGGAGGATC
GTGACGGATGTGGCGGCGAGAGATGTTCATGTCCCTAGTCGGATCTTTAAGAGAATCAGTGGTGATTTGGGGATG
GGGTTGGTGTGGGATGAGAGTTGGGTACAAGGGGAATGGTCTTTGAGGGAGCTTCTAGAGGGGGCTGGGCTGGTG
GTGAAGACGGTTTTCTTGACGGAGTCGTTTCAGGATCGTGTGTATAGTGTTGCTGATGCTGGAGAGGTGTTTGAA
AGGGCTGTTTCTAGTCCGATGTTTCGGAATTTTGGTGATTCAGGGGTGAGGGATGAGGCGAAGAGGTTGTTTGTC
AAGAGGTTTGCTGAGGAGGCGGGTGCGGAGGGGGTGTTGGTCGATGAGGCGAAGATGTATCTGGCTGTCGCGTAT
AAATTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail