Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g11147.t1
Gene name
Locationscaffold_200:1091..4670
Strand+
Gene length (bp)3579
Transcript length (bp)1680
Coding sequence length (bp)1680
Protein length (aa) 560

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 3.0E-07 9 121

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0051179 localization No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 4 26 22
2 33 55 22
3 70 89 19
4 110 127 17

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup11133
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 124.48 Ani_SJS7_1|g10688.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g11040.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g10907.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g10860.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g5660.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g10820.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g11147.t1 (this protein)
Aspergillus niger CBS 147346 Ani_SJS75_1|g8528.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g10809.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g10679.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g8342.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g9093.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g11147.t1
MAGIILQLLALLYVAISLIVTSSLGSDAHSEDVHRTAIAAIASIYVTGVWYAFGWNSIQYLIHAEMLPSSVRTLG
TSILMCIHYANRFALITKAVPTMTLADALQSKETFWFFFVVAFLGFLESLSGRHFTDSGSASTIGASLNQTNPII
TDSFLDGDVVISMNNFNETIDRSAIVEVTFEGKLSTSIHLNISTQLLRMAKNLILIRASDVRELYQAPSDTICSP
SQTFIHPFHFNIPWTSDPNSSSSSSFETGVPLPPSLSFKPIAAYESNDLTLRGHCCIEYCLKARLFNQSSCIAEA
EFPVTLVPPQECPPPICITDFPHEYTLNSFQRIRDLLSRRGLWHLSVETEQPTSFHLNRLNRAGFVPLTWRYQCL
GPSGHHQIIHPPVLFANVQTFLSATTFISVISQSRVPTRTEANKLKNFRLLADTTRVGTTQVRKVRIASWKPKLR
AHDTEGTTSQDQPVWESTAHLIFTFDENDYMPPTFTHPYVSRRYSLIIGIEVDSFRDTNFQLQVPVHVSYDRRQG
NASSICEDVRVPLDAHMVDEDVLLESCSPPPYMA*
Coding >Ani_SJS72_1|g11147.t1
ATGGCTGGAATTATCCTCCAGCTGCTTGCTCTTCTTTATGTTGCTATCTCCCTAATCGTCACGTCCTCGTTGGGC
TCAGATGCGCACTCGGAGGATGTCCACCGCACAGCAATCGCCGCGATCGCTTCTATTTACGTGACGGGCGTCTGG
TATGCCTTTGGCTGGAACTCGATTCAATATTTGATCCACGCAGAGATGCTTCCCTCGTCAGTGCGAACGCTAGGC
ACAAGTATCCTGATGTGCATTCACTATGCCAATAGGTTTGCGCTTATTACCAAGGCCGTTCCAACAATGACGTTG
GCCGATGCACTCCAGTCTAAGGAAACATTTTGGTTCTTTTTCGTGGTTGCGTTCTTGGGGTTCCTCGAAAGCTTG
AGTGGAAGGCACTTCACAGACTCGGGATCCGCGAGTACAATAGGGGCCAGCTTAAACCAGACCAATCCCATTATC
ACCGACAGCTTTCTGGATGGAGATGTCGTCATCTCCATGAACAATTTCAACGAAACCATCGACCGTTCTGCAATA
GTCGAAGTTACTTTTGAGGGCAAGCTATCCACATCCATCCATCTGAACATCTCGACCCAACTCCTCCGCATGGCT
AAAAATCTCATTCTCATCCGAGCATCTGACGTTCGCGAATTATATCAAGCCCCATCCGACACCATCTGCTCACCC
TCCCAAACCTTCATCCACCCTTTCCACTTCAACATCCCTTGGACGAGCGACCCAAACTCATCCTCCTCCTCCTCC
TTCGAAACCGGTGTTCCTCTTCCTCCATCCCTCTCCTTCAAACCTATAGCCGCCTATGAGTCTAACGACCTCACT
CTCCGCGGCCACTGTTGCATAGAATACTGCCTCAAAGCCCGCCTCTTTAATCAAAGCAGCTGTATCGCCGAAGCC
GAGTTCCCAGTAACCCTTGTCCCCCCACAAGAATGTCCTCCCCCTATCTGTATCACCGACTTTCCTCACGAATAT
ACTCTTAACTCATTTCAGCGCATTCGTGATCTCCTATCCCGCCGCGGTCTATGGCACCTGTCCGTTGAGACGGAG
CAACCCACCTCGTTTCATCTTAATCGCCTTAATAGGGCAGGGTTTGTCCCTTTGACATGGCGGTATCAGTGTTTA
GGCCCTTCAGGACATCATCAGATCATTCATCCGCCGGTTCTATTTGCCAACGTTCAAACATTTCTTAGCGCGACG
ACATTTATATCTGTTATATCCCAGTCCCGCGTCCCGACCCGGACTGAAGCCAACAAATTAAAGAATTTCCGGCTC
CTCGCGGATACAACCCGAGTTGGGACTACACAAGTCCGCAAAGTACGGATTGCGTCGTGGAAACCTAAATTACGT
GCGCATGATACTGAAGGTACCACATCCCAGGATCAACCGGTATGGGAATCAACCGCCCATCTAATCTTCACCTTC
GACGAGAACGATTACATGCCGCCTACCTTTACACATCCTTATGTTTCGAGGAGGTATAGTTTAATTATCGGTATT
GAAGTCGACAGTTTTCGAGACACGAATTTTCAACTTCAAGTGCCGGTACACGTGTCCTATGACCGCAGACAGGGT
AATGCCTCGTCTATCTGTGAGGATGTTCGGGTACCGTTAGATGCACATATGGTGGATGAGGATGTATTGTTAGAA
AGTTGTAGTCCGCCGCCTTATATGGCTTGA
Transcript >Ani_SJS72_1|g11147.t1
ATGGCTGGAATTATCCTCCAGCTGCTTGCTCTTCTTTATGTTGCTATCTCCCTAATCGTCACGTCCTCGTTGGGC
TCAGATGCGCACTCGGAGGATGTCCACCGCACAGCAATCGCCGCGATCGCTTCTATTTACGTGACGGGCGTCTGG
TATGCCTTTGGCTGGAACTCGATTCAATATTTGATCCACGCAGAGATGCTTCCCTCGTCAGTGCGAACGCTAGGC
ACAAGTATCCTGATGTGCATTCACTATGCCAATAGGTTTGCGCTTATTACCAAGGCCGTTCCAACAATGACGTTG
GCCGATGCACTCCAGTCTAAGGAAACATTTTGGTTCTTTTTCGTGGTTGCGTTCTTGGGGTTCCTCGAAAGCTTG
AGTGGAAGGCACTTCACAGACTCGGGATCCGCGAGTACAATAGGGGCCAGCTTAAACCAGACCAATCCCATTATC
ACCGACAGCTTTCTGGATGGAGATGTCGTCATCTCCATGAACAATTTCAACGAAACCATCGACCGTTCTGCAATA
GTCGAAGTTACTTTTGAGGGCAAGCTATCCACATCCATCCATCTGAACATCTCGACCCAACTCCTCCGCATGGCT
AAAAATCTCATTCTCATCCGAGCATCTGACGTTCGCGAATTATATCAAGCCCCATCCGACACCATCTGCTCACCC
TCCCAAACCTTCATCCACCCTTTCCACTTCAACATCCCTTGGACGAGCGACCCAAACTCATCCTCCTCCTCCTCC
TTCGAAACCGGTGTTCCTCTTCCTCCATCCCTCTCCTTCAAACCTATAGCCGCCTATGAGTCTAACGACCTCACT
CTCCGCGGCCACTGTTGCATAGAATACTGCCTCAAAGCCCGCCTCTTTAATCAAAGCAGCTGTATCGCCGAAGCC
GAGTTCCCAGTAACCCTTGTCCCCCCACAAGAATGTCCTCCCCCTATCTGTATCACCGACTTTCCTCACGAATAT
ACTCTTAACTCATTTCAGCGCATTCGTGATCTCCTATCCCGCCGCGGTCTATGGCACCTGTCCGTTGAGACGGAG
CAACCCACCTCGTTTCATCTTAATCGCCTTAATAGGGCAGGGTTTGTCCCTTTGACATGGCGGTATCAGTGTTTA
GGCCCTTCAGGACATCATCAGATCATTCATCCGCCGGTTCTATTTGCCAACGTTCAAACATTTCTTAGCGCGACG
ACATTTATATCTGTTATATCCCAGTCCCGCGTCCCGACCCGGACTGAAGCCAACAAATTAAAGAATTTCCGGCTC
CTCGCGGATACAACCCGAGTTGGGACTACACAAGTCCGCAAAGTACGGATTGCGTCGTGGAAACCTAAATTACGT
GCGCATGATACTGAAGGTACCACATCCCAGGATCAACCGGTATGGGAATCAACCGCCCATCTAATCTTCACCTTC
GACGAGAACGATTACATGCCGCCTACCTTTACACATCCTTATGTTTCGAGGAGGTATAGTTTAATTATCGGTATT
GAAGTCGACAGTTTTCGAGACACGAATTTTCAACTTCAAGTGCCGGTACACGTGTCCTATGACCGCAGACAGGGT
AATGCCTCGTCTATCTGTGAGGATGTTCGGGTACCGTTAGATGCACATATGGTGGATGAGGATGTATTGTTAGAA
AGTTGTAGTCCGCCGCCTTATATGGCTTGA
Gene >Ani_SJS72_1|g11147.t1
ATGGCTGGAATTATCCTCCAGCTGCTTGCTCTTCTTTATGTTGCTATCTCCCTAATCGTCACGTCCTCGTTGGGC
TCAGATGCGCACTCGGAGGATGTCCACCGCACAGCAATCGCCGCGATCGCTTCTATTTACGTGACGGGCGTCTGG
TATGCCTTTGGCTGGAACTCGATTCAATATTTGATCCACGCAGAGATGCTTCCCTCGTCAGTGCGAACGCTAGGC
ACAAGTATCCTGATGTGCATTCACTATGCCAATAGGTTTGCGCTTATTACCAAGGTATGAGCTTACTTCCCCTCT
TGTTACCAGTGTGAAACCGGTTGCTCATGAATCAGGCCGTTCCAACAATGACGTTGGCCGATGCACTCCAGTCTA
AGGAAACATTTTGGTTCTTTTTCGTGGTTGCGTTCTTGGGGTTCCTGTGAGGAATGTTTTTGTTGCCGGAAACAA
GCGAGATGATTAGGTGAAATTGCTACTGTGGTGATTTGTTTACAGCCCCGATAATTACTAGTTTTCCGAAGCCTG
ACTTACGTTTCTTCATGCGGCGACAATTGGCTGCCATTCGTTGACCCTCATGGCCTTACAGGTCACTGCGACGTT
GGCTCATCTAACTAGAAAGTTATGCATTCATTTGTTTGGAGGATTTCCACTCAGAGGCCGGACATAGTCTTTCCT
TGATACACAAACAGAATCAATACCTGCAAAAGCAGCTATTTATCCCATCCTCCTCCTAATCGAACAGTACCTCAA
ACTAAGCAGCACACGCTCTATGCAATCTTTCAAACTCGAAAACCAGGTAACTAGAGCGGGAGTCAAAACCTTGAG
AAACAATCTTGCTTCTCAAATACCTACCCTTTAATCATCCCTGAAAATTCTATCAAGCCCTGTTTTCGATTTATC
ACTAGTAAACACTTGTAAGTTTTACCCGAAGGGGCCCCGACAACGCCCTTCCGACAGGATTGAAAGGCTGCGGGC
CCTCTTGTGGACGGTACTAAAAGGTCGGTTAGAAATCCGGTGGGACCTTTCGCTCATGGGGCCTCTCATTGTCAA
CTAACAGTTGACCTTCTAATCATCTGTCTTGTTCAAATGAAGGATGTATTTAGGCATCCTCCATCTGACTTGTGA
AACTCCCGTGCAAGGCCCTCCTGACACCTGTCCAATCGGTAACATGGCTGTTGCGGCCACGTAGGCTAAGCTTTG
CGCTAATGACCAGCGAAAGCTTGAGTGGAAGGCACTTCACAGGTAATTTTCAAATTCAGGCCTGGATTATTGAAA
GGTTTCTGGGGCGCGACCGGAGTCTGTTGCCGTGAGATATGAAATTAAATCCCAGGTCTACATTGTGAGAGAGCT
TTAAGGTAGACACCTCTAGCACCATATTAACTAACAGAACAGATTTAGAAATAATTAAATGGAACACGGCACACT
CTTCCCCGTTCTCTGCAGTGTTGCCAAAACCTTCTGGGGTGGGGCCACCAACCAAGAAAATCCCTCAAGACTCTA
AGGTACTCCACCCTCAGCCCTATCGCGAGGGGTATCCCTCTCTGTTCCGCCGTCCGGAAGAGGAAAGTCGTTCGC
TTTTTCCGGCCACATAACTTGTTCCTCGGCTGGAATAAAAAACACAACTGGAGCGTCTTTCCACGGCACCATCAG
ATGCCCTGATTGCCTGCTGCACACAATTTATTCCTGCTTCCATATTGCTTGTTAAGAGACGCATGATGTTGAATA
TGACAGACTGGTCAAAATTAACTCGTAGTCTGCTTGGATCTTTTCCCGCACCTGATAAATGCTATGCGTGGCTTT
GTTGCCTGCCCGTTTGCCACCGGGAATCTGGGATTGAAATAGGGCGGACCGCGGTGCTCATGAGGGAGCTCAGAG
GATGCACTGTCTGGATCCTGCTTCTATAAATATACGTGTTTCCCATTGTTTATGCCGTAGAGGTGACGGATGCTT
TTTAATCTGCTCTCATCATACACCCAGTTGTCCGCTAACCAGCCCAAAAAGCAAAGTATGAAGTTTTACACCATA
TTCGATCGCAACGATAAGGATATTAACATCAATATTTTAAACTCAAAGTATGGCACCCAGGGTACACATTAAGAT
CAATCATTTTCCGGTATCAGACTCGGGATCCGCGAGTACAATAGGGGCCAGCTTAAACCAGACCAATCCCATTAT
CACCGACAGCTTTCTGGATGGAGATGTCGTCATCTCCATGAACAATTTCAACGAAACCATCGACCGTTCTGCAAT
AGTCGAAGTTACTTTTGAGGGTAAAACTAAGCCAGCACCTAGCTCAGTTCTAACACTAATTCATATTTACCAGGC
AAGCTATCCACATCCATCCATCTGAACATCTCGACCCAACTCCTCCGCATGGCTAAAAATCTCATTGTAAGAAGG
TCCACCTTCTATATTTCTGATTAGGATCTGCATCCTAATTGCCATCCAGCTCATCCGAGCATCTGACGTTCGCGA
ATTATATCAAGCCCCATCCGACACCATCTGCTCACCCTCCCAAACCTTCATCCACCCTTTCCACTTCAACATCCC
TTGGACGAGCGACCCAAACTCATCCTCCTCCTCCTCCTTCGAAACCGGTGTTCCTCTTCCTCCATCCCTCTCCTT
CAAACCTATAGCCGCCTATGAGTCTAACGACCTCACTCTCCGCGGCCACTGTTGCATAGAATACTGCCTCAAAGC
CCGCCTCTTTAATCAAAGCAGCTGTATCGCCGAAGCCGAGTTCCCAGTAACCCTTGTCCCCCCACAAGAATGTCC
TCCCCCTATCTGTATCACCGACTTTCCTCACGAATATACTCTTAACTCATTTCAGCGCATTCGTGATCTCCTATC
CCGCCGCGGTCTATGGCACCTGTCCGTTGAGACGGAGCAACCCACCTCGTTTCATCTTAATCGCCTTAATAGGGC
AGGGTTTGTCCCTTTGACATGGCGGTATCAGTGTTTAGGCCCTTCAGGACATCATCAGATCATTCATCCGCCGGT
TCTATTTGCCAACGTTCAAACATTTCTTAGCGCGACGACATTTATATCTGTTATATCCCAGTCCCGCGTCCCGAC
CCGGACTGAAGCCAACAAATTAAAGAATTTCCGGCTCCTCGCGGATACAACCCGAGTTGGGACTACACAAGTCCG
CAAAGTACGGATTGCGTCGTGGAAACCTAAATTACGTGCGCATGATACTGGTATGTATCTTCCATACCGTCACGT
ATCGACCGCAAACAAGAAACTAACCTCACATACCAAGAAGGTACCACATCCCAGGATCAACCGGTATGGGAATCA
ACCGCCCATCTAATCTTCACCTTCGACGAGAACGATTACATGCCGCCTACCTTTACACATCCTTATGTTTCGAGG
AGGTATAGTTTAATTATCGGTATTGAAGTCGACAGTTTTCGAGACACGAATTTTCAACTTCAAGTGCCGGTACAC
GTGTCCTATGACCGCAGACAGGGTAATGCCTCGTCTATCTGTGAGGATGTTCGGGTACCGTTAGATGCACATATG
GTGGATGAGGATGTATTGTTAGAAAGTTGTAGTCCGCCGCCTTATATGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail