Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g10902.t1
Gene name
Locationscaffold_166:26184..26986
Strand+
Gene length (bp)802
Transcript length (bp)744
Coding sequence length (bp)744
Protein length (aa) 248

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 2.4E-36 2 233

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.5

Transmembrane Domains

Domain # Start End Length
1 33 55 22
2 70 92 22
3 99 121 22
4 134 156 22
5 169 191 22
6 195 212 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g10902.t1
MNEIQTALKAETESVQRTSYLDMLKTKANRRRLVITLSIALFSQWAGNGVVSFYLTKVLQTVGITKSSEQLVITA
CLQIWNLICGIGAALLVDLVGKRSLFHASAIIMIISYVMITAFSASFAEHHERSVGIAVIPFLFIYFAGYGIALT
PLLIAYPCEIWQFSLRTRGLSITWIASCLFASFNSLVNPIALENISWKYYFVFLAVLILYSITEYYMYPETKGRS
LEEIQTLFESENLEPTSTRATD*
Coding >Ani_SJS72_1|g10902.t1
ATGAATGAGATTCAGACTGCGCTCAAAGCTGAGACCGAGTCTGTACAGCGCACAAGCTACCTCGATATGCTGAAG
ACGAAGGCCAATCGCCGCCGTCTCGTAATCACGCTGTCTATAGCCCTGTTCAGCCAGTGGGCAGGAAATGGGGTT
GTCTCGTTCTATCTTACAAAGGTCCTCCAAACCGTTGGCATAACCAAGTCAAGCGAGCAACTTGTCATTACAGCT
TGCCTTCAGATATGGAATCTTATCTGCGGAATTGGCGCGGCCCTTCTGGTGGACTTAGTGGGCAAGCGATCTCTG
TTCCACGCATCGGCAATCATCATGATCATCAGCTATGTTATGATAACAGCGTTCTCGGCGAGCTTTGCAGAGCAT
CATGAACGCTCGGTGGGGATTGCTGTGATCCCCTTTCTGTTCATTTACTTTGCCGGTTACGGCATTGCCCTGACC
CCGTTGCTCATTGCATATCCCTGTGAGATATGGCAATTCAGTCTCCGTACCCGGGGGCTTAGTATCACATGGATT
GCATCCTGTCTGTTTGCCTCGTTCAACTCGCTGGTCAATCCAATCGCGCTCGAAAACATTTCATGGAAGTACTAT
TTCGTATTTCTGGCTGTCCTTATTCTATACAGCATAACTGAGTACTACATGTACCCCGAAACGAAAGGCCGTTCG
TTAGAGGAGATCCAAACGCTGTTTGAGAGCGAAAATCTCGAGCCGACGTCAACCAGGGCGACTGACTAA
Transcript >Ani_SJS72_1|g10902.t1
ATGAATGAGATTCAGACTGCGCTCAAAGCTGAGACCGAGTCTGTACAGCGCACAAGCTACCTCGATATGCTGAAG
ACGAAGGCCAATCGCCGCCGTCTCGTAATCACGCTGTCTATAGCCCTGTTCAGCCAGTGGGCAGGAAATGGGGTT
GTCTCGTTCTATCTTACAAAGGTCCTCCAAACCGTTGGCATAACCAAGTCAAGCGAGCAACTTGTCATTACAGCT
TGCCTTCAGATATGGAATCTTATCTGCGGAATTGGCGCGGCCCTTCTGGTGGACTTAGTGGGCAAGCGATCTCTG
TTCCACGCATCGGCAATCATCATGATCATCAGCTATGTTATGATAACAGCGTTCTCGGCGAGCTTTGCAGAGCAT
CATGAACGCTCGGTGGGGATTGCTGTGATCCCCTTTCTGTTCATTTACTTTGCCGGTTACGGCATTGCCCTGACC
CCGTTGCTCATTGCATATCCCTGTGAGATATGGCAATTCAGTCTCCGTACCCGGGGGCTTAGTATCACATGGATT
GCATCCTGTCTGTTTGCCTCGTTCAACTCGCTGGTCAATCCAATCGCGCTCGAAAACATTTCATGGAAGTACTAT
TTCGTATTTCTGGCTGTCCTTATTCTATACAGCATAACTGAGTACTACATGTACCCCGAAACGAAAGGCCGTTCG
TTAGAGGAGATCCAAACGCTGTTTGAGAGCGAAAATCTCGAGCCGACGTCAACCAGGGCGACTGACTAA
Gene >Ani_SJS72_1|g10902.t1
ATGAATGAGATTCAGACTGCGCTCAAAGCTGAGACCGAGTCTGTACAGCGCACAAGCTACCTCGATATGCTGAAG
ACGAAGGCCAATCGCCGCCGTCTCGTAATCACGCTGTCTATAGCCCTGTTCAGCCAGTGGGCAGGAAATGGGGTT
GTCTCGTTCTATCTTACAAAGGTCCTCCAAACCGTTGGCATAACCAAGTCAAGCGAGCAACTTGTCATTACAGCT
TGCCTTCAGATATGGAATCTTATCTGCGGAATTGGCGCGGCCCTTCTGGTGGACTTAGTGGGCAAGCGATCTCTG
TTCCACGCATCGGCAATCATCATGATCATCAGCTATGTTATGATAACAGCGTTCTCGGCGAGCTTTGCAGAGCAT
CATGAACGCTCGGTGGGGATTGCTGTGATCCCCTTTCTGTTCATTTACTTTGCCGGTTACGGCATTGCCCTGTAG
GCCATTTACCCCTACCGCATGCTGATTAACCGCTGTTGCTCACTATGCTCTCAGGACCCCGTTGCTCATTGCATA
TCCCTGTGAGATATGGCAATTCAGTCTCCGTACCCGGGGGCTTAGTATCACATGGATTGCATCCTGTCTGTTTGC
CTCGTTCAACTCGCTGGTCAATCCAATCGCGCTCGAAAACATTTCATGGAAGTACTATTTCGTATTTCTGGCTGT
CCTTATTCTATACAGCATAACTGAGTACTACATGTACCCCGAAACGAAAGGCCGTTCGTTAGAGGAGATCCAAAC
GCTGTTTGAGAGCGAAAATCTCGAGCCGACGTCAACCAGGGCGACTGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail