Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g109.t1
Gene name
Locationscaffold_001:322935..323910
Strand-
Gene length (bp)975
Transcript length (bp)747
Coding sequence length (bp)747
Protein length (aa) 249

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08566 Pam17 Mitochondrial import protein Pam17 6.8E-68 84 244

GO

GO Term Description Terminal node
GO:0001405 PAM complex, Tim23 associated import motor Yes
GO:0098798 mitochondrial protein-containing complex No
GO:0005575 cellular_component No
GO:0098796 membrane protein complex No
GO:0098800 inner mitochondrial membrane protein complex No
GO:0032991 protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 113 135 22
2 150 181 31

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g109.t1
MHAPSISGMRTAMLSGRLTSKTLGPFAHPSSCTNPLYQALSQTRTASTSSMRVRSTQTLKPTTALRPSTTTTQLP
SSLVLCRANSSAAAAAKSETVRLDWDSFFKLRASRRRYSLASSIVSSLFTTVIGVQVLSTQDLESLGAQVMGLDP
FVVLGMATAACGAAGWLVGPFVGNAVWGLVYRRYKPAVMVKEKEFFDRIRRFRVDPSSNSIANPVPDYYGEKIGS
VQGYRQWLKDQRAYNRKRRHFIV*
Coding >Ani_SJS72_1|g109.t1
ATGCACGCCCCCTCGATCAGCGGGATGCGTACCGCCATGCTGAGCGGACGCCTCACCTCCAAGACGCTGGGCCCC
TTCGCCCACCCCAGCAGCTGCACCAACCCGTTGTATCAAGCGCTCTCTCAGACCCGGACCGCAAGCACCTCCTCC
ATGCGAGTCCGCAGCACACAGACCCTGAAGCCCACCACAGCTCTGCGTCCCTCGACGACGACAACGCAGCTCCCG
AGCTCTCTGGTTCTCTGCCGCGCCAACTCCTCTGCCGCCGCCGCTGCCAAGAGCGAAACCGTCCGTCTCGACTGG
GACTCGTTCTTCAAGCTCCGCGCTAGCCGCCGCCGGTACTCGCTCGCCTCGTCGATCGTGAGCTCCCTGTTCACC
ACGGTCATTGGTGTGCAGGTTCTCTCGACGCAGGATCTGGAGTCCCTCGGGGCGCAGGTCATGGGTCTTGATCCG
TTTGTGGTGCTGGGTATGGCAACGGCGGCGTGCGGTGCGGCGGGTTGGCTTGTCGGTCCGTTTGTGGGGAATGCT
GTTTGGGGGTTGGTTTATCGCAGATATAAGCCTGCTGTTATGGTGAAAGAGAAGGAATTCTTCGACCGCATTAGA
CGCTTCCGTGTCGACCCCTCGTCCAACTCCATTGCTAACCCCGTTCCTGATTACTATGGTGAGAAGATCGGCAGT
GTGCAGGGTTATCGCCAGTGGTTGAAGGATCAGCGGGCGTATAACCGCAAGAGACGTCATTTCATCGTTTAG
Transcript >Ani_SJS72_1|g109.t1
ATGCACGCCCCCTCGATCAGCGGGATGCGTACCGCCATGCTGAGCGGACGCCTCACCTCCAAGACGCTGGGCCCC
TTCGCCCACCCCAGCAGCTGCACCAACCCGTTGTATCAAGCGCTCTCTCAGACCCGGACCGCAAGCACCTCCTCC
ATGCGAGTCCGCAGCACACAGACCCTGAAGCCCACCACAGCTCTGCGTCCCTCGACGACGACAACGCAGCTCCCG
AGCTCTCTGGTTCTCTGCCGCGCCAACTCCTCTGCCGCCGCCGCTGCCAAGAGCGAAACCGTCCGTCTCGACTGG
GACTCGTTCTTCAAGCTCCGCGCTAGCCGCCGCCGGTACTCGCTCGCCTCGTCGATCGTGAGCTCCCTGTTCACC
ACGGTCATTGGTGTGCAGGTTCTCTCGACGCAGGATCTGGAGTCCCTCGGGGCGCAGGTCATGGGTCTTGATCCG
TTTGTGGTGCTGGGTATGGCAACGGCGGCGTGCGGTGCGGCGGGTTGGCTTGTCGGTCCGTTTGTGGGGAATGCT
GTTTGGGGGTTGGTTTATCGCAGATATAAGCCTGCTGTTATGGTGAAAGAGAAGGAATTCTTCGACCGCATTAGA
CGCTTCCGTGTCGACCCCTCGTCCAACTCCATTGCTAACCCCGTTCCTGATTACTATGGTGAGAAGATCGGCAGT
GTGCAGGGTTATCGCCAGTGGTTGAAGGATCAGCGGGCGTATAACCGCAAGAGACGTCATTTCATCGTTTAG
Gene >Ani_SJS72_1|g109.t1
ATGCACGCCCCCTCGATCAGCGGGATGCGTACCGCCATGCTGAGCGGACGCCTCACCTCCAAGACGCTGGGCCCC
TTCGCCCACCCCAGCAGCTGCACCAACCCGTTGTATCAAGCGCTCTCTCAGACCCGGACCGCAAGCACCTCCTCC
ATGCGAGTCCGCAGCACACAGACCCTGAAGCCCACCACAGCTCTGCGTCCCTCGACGACGACAACGCAGCTCCCG
AGCTCTCTGGTTCTCTGCCGCGCCAACTCCTCTGCCGCCGCCGCTGCCAAGAGCGAAACCGTCCGTCTCGACTGG
GACTCGTTCTTCAAGCTCCGCGCTAGCCGCCGCCGGTACTCGCTCGCCTCGTCGATCGTGAGCTCCCTGTTCACC
ACGGTCATTGGTGTGCAGGTTCTCTCGACGCAGGATCTGGAGTCCCTCGGGGCGCAGGTCATGGGTCTTGATCCG
TTTGTGGTGCTGGGTATGGCAACGGCGGCGTGCGGTGCGGCGGGTTGGCTTGTCGGTCCGTTTGTGGGGAATGCT
GTTTGGGGGTTGGTTTATCGCAGATATAAGCCTGCTGTTATGGTGGTAAGCTTTTTTTTTTTTTTTTTTTTTTTT
TTTGGACTTTTGGGGTTTATTATTTTGGGGNNNNNNNNNNGGGGTGTGTGTTTGGGGGGTTGTTTTTTTTTTTTT
TTTTGTTGTTTTTTTTGTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCCCCTTTTCCCTTAATTAAG
TTGCTGTTGAGAAGAAACGTGGATACTGATAGTGGGTTGTGTGTGTAGAAAGAGAAGGAATTCTTCGACCGCATT
AGACGCTTCCGTGTCGACCCCTCGTCCAACTCCATTGCTAACCCCGTTCCTGATTACTATGGTGAGAAGATCGGC
AGTGTGCAGGGTTATCGCCAGTGGTTGAAGGATCAGCGGGCGTATAACCGCAAGAGACGTCATTTCATCGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail