Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g10797.t1
Gene name
Locationscaffold_159:35312..39247
Strand-
Gene length (bp)3935
Transcript length (bp)2919
Coding sequence length (bp)2919
Protein length (aa) 973

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13347 MFS_2 MFS/sugar transport protein 2.1E-10 52 308

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.5

Transmembrane Domains

Domain # Start End Length
1 37 59 22
2 74 96 22
3 109 128 19
4 228 247 19
5 285 307 22
6 339 361 22
7 393 415 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g10797.t1
MTERSNEAEPLIHGGWVPPDSHIPPGPSTPDEASKSSAYLFTLTLAMGGLQIVYSIQHSSGSPYLLSLGMSKALL
AFVWIAGPLTGTLVQPYIGIRSDNCRISWGKRKPFMVFGGVLLAICLLALAWVRELVGGLFGLFGLDAQAAETKT
AVIVAATLLMYCQDFAINTVQAATRAFIVDNAPAHQQEAANAWASRHVSAGNIFGFIIGGLNLPRIIPFLGNTQF
KGISVIASVSLAITLSIGCAYIKEKDPRMEPSSSASLGFVSLLQSIKESVHRLPLRIRQVYIIQAAAWFGWFSFL
FYATTYIGQLYVNPIFESHQDLSDDEINKVWEDATRIGTLAMLVNALVSFAASIILPMLVVPSEKQEAAEASTSS
SSFRLKLRIPGLSLRRAWLLSHCLFAICMFSTFFVSSPGQASVMTGIIGIAWAVTAWAPYALIASEIAQEDPGRP
AHRRGWAPLSTQFGTIIDQTDPFHTLRDVQHLGRWRFWQPHVPWYRVVKPPLVGPVINANLPCGLCGRKTVHVSR
RPLAQPTGKAAWSILLNVIHPPSTTPEEPSQTGSLVSTKSPFKTEHVVTISGEPPVQLPTWDSLPRGPLTKHKLT
ACTVISRATLMALFTVTNARPVFRHSGASGHRAAYASYCGQWYVEWPIGDAAHVHFAAHDSHTLNKDVYPPTFEV
RVDRCLRMLAGVIESPASSPPFKCAFPGRKASGRWILEHIVRGFGGAHGSRHLYNMIGGNVNEVDLLLMKPITED
NNDYDISSELESTSITLSLPSTESNPRHQTTTTHSVTLHIPPHETTILNTCLDYLPWTSLSWSIHRGLRDILLAF
AKPRMNHYRARLAHTLRTTVSTHADRLIARGWDAQFVRNGSMADLAAGAVLAGSGNSGDAVRIVTDIAAVWCEGR
GNGDGLAVISLDETMFWRVPHQPVEEVNREGGDSGELSSMAVVALVKFFVLEWSVDLDYQMYHDLPLELYLG*
Coding >Ani_SJS72_1|g10797.t1
ATGACAGAGCGCAGCAACGAGGCGGAGCCTCTCATCCACGGTGGATGGGTGCCGCCGGACTCGCATATACCGCCA
GGTCCATCCACCCCTGATGAGGCATCCAAGAGCAGCGCTTACCTCTTCACACTGACCCTAGCCATGGGAGGTCTC
CAGATTGTCTATTCGATCCAGCATTCCAGTGGATCACCGTATCTTCTATCTCTCGGAATGAGCAAAGCGCTGCTT
GCCTTTGTCTGGATTGCAGGGCCCCTTACAGGCACTCTTGTGCAGCCTTACATTGGCATCCGAAGTGACAATTGC
CGCATCTCCTGGGGCAAGCGAAAGCCGTTCATGGTATTTGGTGGCGTGCTCTTGGCTATCTGTCTGCTAGCTCTG
GCTTGGGTGCGGGAACTTGTCGGCGGCTTATTTGGCCTATTTGGCCTTGATGCTCAGGCAGCTGAAACCAAAACT
GCAGTCATCGTGGCTGCAACGCTCTTAATGTACTGCCAAGACTTTGCCATTAACACTGTCCAAGCAGCTACCCGG
GCTTTCATCGTCGATAATGCCCCGGCTCATCAGCAGGAAGCGGCAAATGCCTGGGCAAGCCGTCACGTCAGCGCA
GGGAACATCTTTGGCTTCATCATTGGCGGGCTGAATCTGCCGAGGATTATCCCATTCCTCGGGAATACACAATTC
AAAGGGATCAGCGTAATTGCTAGTGTCTCACTAGCAATCACTCTATCCATTGGTTGCGCTTATATCAAGGAAAAG
GATCCGCGCATGGAGCCATCTTCATCTGCAAGTCTAGGGTTTGTATCCCTGCTTCAGTCCATTAAAGAATCGGTT
CATCGCCTCCCTTTGCGTATTCGCCAGGTCTATATTATCCAGGCTGCAGCATGGTTCGGGTGGTTTTCGTTTTTG
TTCTACGCCACCACTTATATAGGGCAGTTGTATGTGAACCCCATCTTCGAAAGTCATCAAGATCTATCGGATGAT
GAGATCAACAAGGTATGGGAGGATGCTACACGCATCGGTACTTTGGCTATGCTCGTGAATGCGCTAGTGTCTTTT
GCAGCGAGTATCATCCTGCCAATGCTAGTGGTTCCTTCGGAGAAACAAGAGGCAGCTGAAGCGAGCACTAGCTCG
AGCAGCTTCCGCTTGAAGTTAAGGATTCCCGGTTTATCACTACGCCGCGCATGGCTTCTCTCTCATTGCCTATTT
GCCATCTGCATGTTCAGCACATTCTTTGTCTCGTCCCCGGGACAAGCATCGGTAATGACTGGCATAATTGGCATT
GCCTGGGCTGTCACGGCGTGGGCACCATATGCCCTGATCGCATCTGAGATCGCACAGGAAGACCCTGGGCGACCG
GCACATCGTCGAGGCTGGGCTCCATTGTCCACCCAATTTGGGACAATCATCGATCAGACTGACCCCTTCCACACC
CTGCGAGATGTACAGCACCTGGGTCGCTGGCGGTTCTGGCAGCCACACGTTCCTTGGTATAGAGTCGTGAAGCCC
CCTCTTGTCGGGCCTGTGATCAACGCCAATCTGCCATGCGGGCTCTGTGGCAGAAAGACTGTCCATGTCAGTCGA
CGGCCACTTGCGCAGCCAACTGGTAAGGCTGCATGGTCCATCCTGCTCAACGTCATTCATCCACCTTCTACCACC
CCCGAGGAGCCCTCCCAGACCGGGTCGTTAGTCTCTACCAAAAGCCCCTTCAAGACTGAGCACGTCGTGACCATC
TCCGGAGAACCGCCCGTCCAGCTGCCAACCTGGGATAGCCTTCCTCGAGGCCCTCTCACCAAGCACAAGCTAACC
GCTTGCACGGTCATCTCTCGCGCAACCCTCATGGCTCTATTCACCGTGACCAATGCTCGACCAGTGTTTCGGCAC
AGCGGCGCATCTGGCCATCGAGCCGCCTATGCCTCCTACTGCGGACAATGGTACGTCGAATGGCCCATTGGCGAC
GCCGCACACGTCCACTTCGCGGCCCACGATTCGCACACGCTGAACAAAGACGTCTACCCTCCAACCTTTGAAGTA
CGTGTCGACCGCTGTCTGCGCATGCTAGCCGGGGTCATCGAAAGCCCTGCGTCCTCTCCACCATTCAAATGCGCC
TTCCCCGGCCGCAAAGCATCGGGCAGATGGATTCTCGAACACATCGTGCGAGGCTTTGGCGGCGCCCACGGCAGC
AGACACCTCTACAACATGATTGGAGGCAACGTTAATGAAGTCGATCTTCTATTGATGAAGCCCATCACCGAGGAC
AATAATGACTACGACATATCATCAGAACTCGAATCCACTTCCATTACTCTCTCCCTTCCCAGCACTGAATCCAAC
CCCCGCCACCAAACCACCACCACCCACTCCGTAACCCTCCACATCCCACCCCACGAAACCACCATCCTCAACACC
TGCCTCGACTACCTCCCCTGGACCTCCCTCTCCTGGTCCATCCACCGCGGCCTCCGCGACATCCTCCTCGCCTTC
GCCAAACCACGCATGAACCACTACCGCGCTCGACTCGCTCATACCCTCCGCACCACCGTCTCCACACACGCAGAC
CGGCTCATTGCCCGCGGCTGGGACGCCCAGTTCGTCCGCAATGGCAGCATGGCCGACCTAGCCGCGGGTGCCGTG
TTAGCCGGGAGCGGCAATTCCGGGGATGCGGTGCGCATCGTCACGGATATAGCGGCGGTATGGTGTGAGGGGCGA
GGAAATGGTGATGGGTTGGCTGTCATATCGTTGGATGAGACGATGTTTTGGAGGGTTCCCCACCAGCCGGTGGAA
GAAGTAAATAGAGAAGGTGGTGATAGTGGAGAGTTAAGTTCCATGGCTGTTGTGGCGCTAGTCAAGTTCTTTGTT
TTGGAATGGAGTGTGGACTTGGATTATCAGATGTATCATGATTTACCGTTGGAGCTGTATTTGGGCTAG
Transcript >Ani_SJS72_1|g10797.t1
ATGACAGAGCGCAGCAACGAGGCGGAGCCTCTCATCCACGGTGGATGGGTGCCGCCGGACTCGCATATACCGCCA
GGTCCATCCACCCCTGATGAGGCATCCAAGAGCAGCGCTTACCTCTTCACACTGACCCTAGCCATGGGAGGTCTC
CAGATTGTCTATTCGATCCAGCATTCCAGTGGATCACCGTATCTTCTATCTCTCGGAATGAGCAAAGCGCTGCTT
GCCTTTGTCTGGATTGCAGGGCCCCTTACAGGCACTCTTGTGCAGCCTTACATTGGCATCCGAAGTGACAATTGC
CGCATCTCCTGGGGCAAGCGAAAGCCGTTCATGGTATTTGGTGGCGTGCTCTTGGCTATCTGTCTGCTAGCTCTG
GCTTGGGTGCGGGAACTTGTCGGCGGCTTATTTGGCCTATTTGGCCTTGATGCTCAGGCAGCTGAAACCAAAACT
GCAGTCATCGTGGCTGCAACGCTCTTAATGTACTGCCAAGACTTTGCCATTAACACTGTCCAAGCAGCTACCCGG
GCTTTCATCGTCGATAATGCCCCGGCTCATCAGCAGGAAGCGGCAAATGCCTGGGCAAGCCGTCACGTCAGCGCA
GGGAACATCTTTGGCTTCATCATTGGCGGGCTGAATCTGCCGAGGATTATCCCATTCCTCGGGAATACACAATTC
AAAGGGATCAGCGTAATTGCTAGTGTCTCACTAGCAATCACTCTATCCATTGGTTGCGCTTATATCAAGGAAAAG
GATCCGCGCATGGAGCCATCTTCATCTGCAAGTCTAGGGTTTGTATCCCTGCTTCAGTCCATTAAAGAATCGGTT
CATCGCCTCCCTTTGCGTATTCGCCAGGTCTATATTATCCAGGCTGCAGCATGGTTCGGGTGGTTTTCGTTTTTG
TTCTACGCCACCACTTATATAGGGCAGTTGTATGTGAACCCCATCTTCGAAAGTCATCAAGATCTATCGGATGAT
GAGATCAACAAGGTATGGGAGGATGCTACACGCATCGGTACTTTGGCTATGCTCGTGAATGCGCTAGTGTCTTTT
GCAGCGAGTATCATCCTGCCAATGCTAGTGGTTCCTTCGGAGAAACAAGAGGCAGCTGAAGCGAGCACTAGCTCG
AGCAGCTTCCGCTTGAAGTTAAGGATTCCCGGTTTATCACTACGCCGCGCATGGCTTCTCTCTCATTGCCTATTT
GCCATCTGCATGTTCAGCACATTCTTTGTCTCGTCCCCGGGACAAGCATCGGTAATGACTGGCATAATTGGCATT
GCCTGGGCTGTCACGGCGTGGGCACCATATGCCCTGATCGCATCTGAGATCGCACAGGAAGACCCTGGGCGACCG
GCACATCGTCGAGGCTGGGCTCCATTGTCCACCCAATTTGGGACAATCATCGATCAGACTGACCCCTTCCACACC
CTGCGAGATGTACAGCACCTGGGTCGCTGGCGGTTCTGGCAGCCACACGTTCCTTGGTATAGAGTCGTGAAGCCC
CCTCTTGTCGGGCCTGTGATCAACGCCAATCTGCCATGCGGGCTCTGTGGCAGAAAGACTGTCCATGTCAGTCGA
CGGCCACTTGCGCAGCCAACTGGTAAGGCTGCATGGTCCATCCTGCTCAACGTCATTCATCCACCTTCTACCACC
CCCGAGGAGCCCTCCCAGACCGGGTCGTTAGTCTCTACCAAAAGCCCCTTCAAGACTGAGCACGTCGTGACCATC
TCCGGAGAACCGCCCGTCCAGCTGCCAACCTGGGATAGCCTTCCTCGAGGCCCTCTCACCAAGCACAAGCTAACC
GCTTGCACGGTCATCTCTCGCGCAACCCTCATGGCTCTATTCACCGTGACCAATGCTCGACCAGTGTTTCGGCAC
AGCGGCGCATCTGGCCATCGAGCCGCCTATGCCTCCTACTGCGGACAATGGTACGTCGAATGGCCCATTGGCGAC
GCCGCACACGTCCACTTCGCGGCCCACGATTCGCACACGCTGAACAAAGACGTCTACCCTCCAACCTTTGAAGTA
CGTGTCGACCGCTGTCTGCGCATGCTAGCCGGGGTCATCGAAAGCCCTGCGTCCTCTCCACCATTCAAATGCGCC
TTCCCCGGCCGCAAAGCATCGGGCAGATGGATTCTCGAACACATCGTGCGAGGCTTTGGCGGCGCCCACGGCAGC
AGACACCTCTACAACATGATTGGAGGCAACGTTAATGAAGTCGATCTTCTATTGATGAAGCCCATCACCGAGGAC
AATAATGACTACGACATATCATCAGAACTCGAATCCACTTCCATTACTCTCTCCCTTCCCAGCACTGAATCCAAC
CCCCGCCACCAAACCACCACCACCCACTCCGTAACCCTCCACATCCCACCCCACGAAACCACCATCCTCAACACC
TGCCTCGACTACCTCCCCTGGACCTCCCTCTCCTGGTCCATCCACCGCGGCCTCCGCGACATCCTCCTCGCCTTC
GCCAAACCACGCATGAACCACTACCGCGCTCGACTCGCTCATACCCTCCGCACCACCGTCTCCACACACGCAGAC
CGGCTCATTGCCCGCGGCTGGGACGCCCAGTTCGTCCGCAATGGCAGCATGGCCGACCTAGCCGCGGGTGCCGTG
TTAGCCGGGAGCGGCAATTCCGGGGATGCGGTGCGCATCGTCACGGATATAGCGGCGGTATGGTGTGAGGGGCGA
GGAAATGGTGATGGGTTGGCTGTCATATCGTTGGATGAGACGATGTTTTGGAGGGTTCCCCACCAGCCGGTGGAA
GAAGTAAATAGAGAAGGTGGTGATAGTGGAGAGTTAAGTTCCATGGCTGTTGTGGCGCTAGTCAAGTTCTTTGTT
TTGGAATGGAGTGTGGACTTGGATTATCAGATGTATCATGATTTACCGTTGGAGCTGTATTTGGGCTAG
Gene >Ani_SJS72_1|g10797.t1
ATGACAGAGCGCAGCAACGAGGCGGAGCCTCTCATCCACGGTGGATGGGTGCCGCCGGACTCGCATATACCGCCA
GGTCCATCCACCCCTGATGAGGCATCCAAGAGCAGCGCTTACCTCTTCACACTGACCCTAGCCATGGGAGGGTGA
GTACTTAATGGCATGAGCTTGCTCTGTTGTCCTCGTTGACCCGTTTCTTAGTCTCCAGATTGTCTATTCGATCCA
GCATTCCAGTGGATCAGTAAGTTGTAAAGCTCAAGAAATCAAACAAATCTCAGTAGCTAATCCAACTTCGCTTAT
CCCATAGCCGTATCTTCTATCTCTCGGAATGAGCAAAGCGCTGCTTGCCTTTGTCTGGATTGCAGGGCCCCTTAC
AGGCACTCTTGTGCAGCCTTACATTGGCATCCGAAGTGACAATTGCCGCATCTCCTGGGGCAAGCGAAAGCCGTT
CATGGTATTTGGTGGCGTGCTCTTGGCTATCTGTCTGCTAGCTCTGGCTTGGGTGCGGGAACTTGTCGGCGGCTT
ATTTGGCCTATTTGGCCTTGATGCTCAGGCAGCTGAAACCAAAACTGCAGTCATCGTGGCTGCAACGCTCTTAAT
GTACTGCCAAGACTTTGCCATTAACACTGGTATGGTATCTACGCTAACTGGCTCTTATGAAACATGCTTCTGACA
TCCTGTCACAGTCCAAGCAGCTACCCGGGCTTTCATCGTCGATAATGCCCCGGCTCATCAGCAGGAAGCGGCAAA
TGCCTGGGCAAGCCGTCACGTCAGCGCAGGGAACATCTTTGGCTTCATCATTGGCGGGCTGAATCTGCCGAGGAT
TATCCCATTCCTCGGGAATACACAATTCAAAGGGATCAGCGTAATTGCTAGTGTCTCACTAGCAATCACTCTATC
CATTGGTTGCGCTTATATCAAGGAAAAGGATCCGCGCATGGAGCCATCTTCATCTGCAAGTCTAGGGTTTGTATC
CCTGCTTCAGTCCATTAAAGAATCGGTTCATCGCCTCCCTTTGCGTATTCGCCAGGTCTATATTATCCAGGCTGC
AGCATGGTTCGGGTGGTTTTCGTTTTTGTTCTACGCCACCACTTATATAGGGCAGTTGTATGTGAACCCCATCTT
CGAAAGTCATCAAGATCTATCGGATGATGAGATCAACAAGGTATGGGAGGATGCTACACGCATCGGTACTTTGGC
TATGCTCGTGAATGCGCTAGTGTCTTTTGCAGCGAGTATCATCCTGCCAATGCTAGTGGTTCCTTCGGAGAAACA
AGAGGCAGCTGAAGCGAGCACTAGCTCGAGCAGCTTCCGCTTGAAGTTAAGGATTCCCGGTTTATCACTACGCCG
CGCATGGCTTCTCTCTCATTGCCTATTTGCCATCTGCATGTTCAGCACATTCTTTGTCTCGTCCCCGGGACAAGC
ATCGGTAATGACTGGCATAATTGGCATTGCCTGGGCTGTCACGGCGTGGGCACCATATGCCCTGATCGCATCTGA
GATCGCACAGGAAGACCCTGGGCGACCGGCACATCGTCGAGTAAGATCCGGCGAAGTAGAAGGGGCAAGCAGTCT
GCCATATGTTCAGGAAACCGATGAACCGAGAAGGACGGCACAAAAATCAGCAAACCAAGCCGGCGTCGTTCTTGG
TCTACATAATGTCGCTATTTCCTTCCCCCAGATTATTTCCAGTGCTATAGGAAGCGTCATCTTCAAGGCGCTACA
GAAGCCACGAGGGCAGCCTTGGGATACCAGCACAAGCTGGGTCATGAGACTGGGAGGATGTGCTGCCATTCTAGC
AGCTTTCTTGACAATGAGGCTCCAAGAGCAGTCTAGGAGAAAGTAGAACGCATATCGGAAACCGCACAATCTCGA
GACCATACTTGGGAATAAAAAATTACAAATAGACCTTGGTACTCGACTCCTTTCATTCTCGAAGGCCACCCAAGG
CCATTTTCTGCCTGCCAACACAATGGTATCTGGCAGCATCGTAGCGGCACTCAAAGCTGGGAGATGAAGCATTCC
GTTCCACTATTATGATCATGCAAGGCACTAGAGAGTCTCGTGAAGGGAAACCAGGCGCAATCAGCATACATTCTA
TTTGCGGGGATGAACATCGATGGTGTTCTCTGCCAGAGCCAACTCGGATCCTGCGATGACAGCGGACGATGGTTG
GCGGCCGATGCGCTCAGATGCATTAGCGCAGCAACCCTTCACCATCCCTCCAACTTACTTATCCCAAGCCCCTCC
AGAGATCATGAGCTCGCCTTGGATGTCAGTCAAGAGCACCATATCCCGGCTGTTGGCTGGGTTAAGCATCCGAAT
GGATGTTTCGTCAACGGTGGCTACCTGGCTCTCTCTCGCCGTTACGGTGGTAGGGCTGGGCTCCATTGTCCACCC
AATTTGGGACAATCATCGATCAGACTGACCCCTTCCACACCCTGCGAGATGTACAGCACCTGGGTCGCTGGCGGT
TCTGGCAGCCACACGTTCCTTGGTATAGAGTCGTGAAGCCCCCTCTTGTCGGGCCTGTGATCAACGCCAATCTGC
CATGCGGGCTCTGTGGCAGAAAGACTGTCCATGTCAGTCGACGGCCACTTGCGCAGCCAACTGGTAAGGCTGCAT
GGTCCATCCTGCTCAACGTCATTCATCCACCTTCTACCACCCCCGAGGAGCCCTCCCAGACCGGGTCGTTAGTCT
CTACCAAAAGCCCCTTCAAGACTGAGCACGTCGTGACCATCTCCGGAGAACCGCCCGTCCAGCTGCCAACCTGGG
ATAGCCTTCCTCGAGGCCCTCTCACCAAGCACAAGCTAACCGCTTGCACGGTCATCTCTCGCGCAACCCTCATGG
CTCTATTCACCGTGACCAATGCTCGACCAGTGTTTCGGCACAGCGGCGCATCTGGCCATCGAGCCGCCTATGCCT
CCTACTGCGGACAATGGTACGTCGAATGGCCCATTGGCGACGCCGCACACGTCCACTTCGCGGCCCACGATTCGC
ACACGCTGAACAAAGACGTCTACCCTCCAACCTTTGAAGTACGTGTCGACCGCTGTCTGCGCATGCTAGCCGGGG
TCATCGAAAGCCCTGCGTCCTCTCCACCATTCAAATGCGCCTTCCCCGGCCGCAAAGCATCGGGCAGATGGATTC
TCGAACACATCGTGCGAGGCTTTGGCGGCGCCCACGGCAGCAGACACCTCTACAACATGATTGGAGGCAACGTTA
ATGAAGTCGATCTTCTATTGATGAAGCCCATCACCGAGGACAATAATGACTACGACATATCATCAGAACTCGAAT
CCACTTCCATTACTCTCTCCCTTCCCAGCACTGAATCCAACCCCCGCCACCAAACCACCACCACCCACTCCGTAA
CCCTCCACATCCCACCCCACGAAACCACCATCCTCAACACCTGCCTCGACTACCTCCCCTGGACCTCCCTCTCCT
GGTCCATCCACCGCGGCCTCCGCGACATCCTCCTCGCCTTCGCCAAACCACGCATGAACCACTACCGCGCTCGAC
TCGCTCATACCCTCCGCACCACCGTCTCCACACACGCAGACCGGCTCATTGCCCGCGGCTGGGACGCCCAGTTCG
TCCGCAATGGCAGCATGGCCGACCTAGCCGCGGGTGCCGTGTTAGCCGGGAGCGGCAATTCCGGGGATGCGGTGC
GCATCGTCACGGATATAGCGGCGGTATGGTGTGAGGGGCGAGGAAATGGTGATGGGTTGGCTGTCATATCGTTGG
ATGAGACGATGTTTTGGAGGGTTCCCCACCAGCCGGTGGAAGAAGTAAATAGAGAAGGTGGTGATAGTGGAGAGT
TAAGTTCCATGGCTGTTGTGGCGCTAGTCAAGTTCTTTGTTTTGGAATGGAGTGTGGACTTGGATTATCAGATGT
ATCATGATTTACCGTTGGAGCTGTATTTGGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail