Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g10134.t1
Gene name
Locationscaffold_126:15835..20565
Strand+
Gene length (bp)4730
Transcript length (bp)3666
Coding sequence length (bp)3666
Protein length (aa) 1222

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02487 CLN3 CLN3 protein 2.0E-160 41 435
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 9.0E-25 673 838
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 9.4E-10 859 979

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0016787 hydrolase activity Yes
GO:0110165 cellular anatomical entity No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.5

Transmembrane Domains

Domain # Start End Length
1 42 64 22
2 74 96 22
3 103 122 19
4 132 154 22
5 161 183 22
6 193 212 19
7 278 297 19
8 317 334 17
9 347 369 22
10 374 396 22
11 409 431 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g10134.t1
MSSAPDGQPMLPLPGAPSSSWSRFRERFGALFHGADPRVCVAFWLLGLINNVLYVIILSAALDLVGPSVPKGVVL
LADVIPSFGTKLIAPYFIHLVPYPARVLFCVLCSAVGMLLVALSPAYTDGGSISTKIAGIILASLSSGGGELSFL
ALTHFYGPFSLAAWGSGTGAAGLVGAGAYAVATTSMGLSVRSTLLAAACLPAIMVVSFFAILPRAPIRTLAAAPV
EYRAIDQEDRDDLLDERHGLLGSSAPPSRNKRSDASHELGLQVFKANLQRARGLFFPFMLPLLLVYVAEYTINQG
VSPTLLFPLKDSPFEHYRAFYPAYNAIYQVGVFISRSSTPFFRIHDLYLPSLLQIINLVVLTLHALFDFIPSVYI
IFIVIFWEGLLGGLVYVNTFAEIGDRVPKEDREFSLGATTVSDSAGICIAGFLGMAFETSFKASIDCCCLIDTRG
CFGKMIDHVLGRPSTKFRKIQVLAVLVFWSTYLLRGNKNGPPFIRKISSRLSKKLSVWQTTVLVFLWLYICRNFA
KIVGLECPEPLANLYSRSFFRATWITTGLDAGFWTAMGIKPKWLRDIASLVFSGYYLIAAEQADEKVRRVRATLT
VEHMRVSWNKSTTPYLWALAKLGRPRLTKYPPRAIRIPRPASSIYKEPTNAWLYFDGSLAALRDQTCIVLDIPGG
GFVSMSPRHSEDRLLAWAARTKVPVLSLDYKKAPEYPYPYALNECYDVYHSIVSTRGRCLGLNGRTRPRVVITGD
SAGGNLATGVTLMILQSGSTHASRWQGQNMLPPPDGLVLPYPALNMKIESWMTEEQMALIQEKSTRRTNESVLRR
KDMDYHRLTPFTSPGTSFGDFQRDSFSDADLEVGNLVDATSEKLAQQQKMDVTEEEVAAITEHQPKQIRTRLAVS
SMISYVNDRILTPEMMRAMIILYIGPHNRPDFNTDYLLSPALAPEELLARFPKTYIITGERDPLVDDTVIFAGRL
RQAKLRQFQERQELGLEKSYRRFNAKDHVEVSLLPGISHGFMQMAGFFPDSWKHIYRCATWIQDLFDLAQTKKSS
SGHLRALTNGAQMRKGPKSVPRGNSSRNHRRRLTGESSGDEDRPLEIGIKKLTPLTPLHRSSSAPIDSTEIDSQD
IAAKDGDSEDAKKERIRSVSRGRTLRPGITRKQRPIPMRLTIPPRDGYISGSPSPIPLRERNRSINSLASEEDLL
DRRMNGLAGGLMGIGEGARTP*
Coding >Ani_SJS72_1|g10134.t1
ATGTCTTCTGCTCCTGACGGGCAACCAATGCTGCCTCTTCCTGGAGCCCCGTCTTCTTCATGGTCCCGATTTCGT
GAGAGATTCGGTGCACTATTTCATGGCGCTGACCCCAGAGTCTGTGTTGCATTCTGGCTACTTGGATTGATCAAC
AATGTCCTCTATGTTATCATTTTGTCCGCAGCCCTCGATTTAGTTGGTCCTAGTGTCCCCAAGGGCGTCGTTCTT
CTCGCAGACGTCATTCCCTCATTCGGAACCAAGCTGATAGCACCCTACTTTATTCATTTGGTTCCATATCCCGCT
CGAGTATTGTTCTGTGTGCTATGTTCAGCCGTGGGTATGCTTCTGGTGGCCCTGAGCCCAGCGTATACAGATGGC
GGTTCAATTTCCACCAAAATCGCGGGCATTATTCTGGCGAGCTTGTCGAGCGGAGGAGGCGAACTGAGCTTCCTA
GCACTGACGCACTTCTACGGCCCGTTCAGTCTGGCAGCCTGGGGTAGTGGTACCGGAGCCGCCGGGCTGGTCGGG
GCTGGTGCGTACGCCGTCGCAACTACCTCTATGGGGCTCAGTGTCAGGTCGACACTCCTAGCAGCTGCCTGCCTG
CCAGCAATCATGGTTGTGAGCTTCTTCGCCATTCTGCCAAGAGCTCCCATACGGACATTGGCCGCTGCACCTGTT
GAGTATCGTGCAATTGACCAGGAAGATCGGGATGACCTTCTGGATGAGCGGCACGGTCTACTCGGCTCCTCAGCT
CCCCCGAGCCGAAACAAGAGGAGCGACGCGAGTCATGAGCTCGGCTTGCAGGTGTTCAAAGCTAACCTGCAGCGA
GCTAGGGGACTTTTCTTTCCCTTCATGCTCCCCCTTCTGCTAGTCTATGTGGCCGAATACACAATCAACCAAGGG
GTTTCTCCGACCCTGCTGTTTCCACTTAAAGATTCGCCGTTTGAACATTATCGTGCATTTTATCCCGCGTACAAT
GCGATCTATCAGGTTGGTGTTTTCATCTCGCGATCGTCCACCCCTTTCTTTCGGATTCACGATCTTTACCTTCCG
TCACTGCTGCAAATCATCAATTTGGTCGTATTGACATTGCACGCCTTGTTTGACTTCATCCCGAGCGTGTACATA
ATATTTATAGTCATCTTCTGGGAAGGGCTATTAGGGGGGCTGGTTTATGTCAATACATTCGCCGAAATCGGGGAC
CGGGTGCCGAAGGAAGACCGAGAATTCTCGCTCGGAGCGACGACTGTCAGCGATTCTGCCGGAATTTGTATAGCG
GGCTTTCTGGGAATGGCGTTTGAGACTTCTTTCAAAGCCTCTATAGACTGCTGCTGCCTGATTGATACCCGGGGG
TGTTTCGGAAAGATGATAGACCACGTCCTTGGGCGGCCATCTACAAAATTCCGGAAAATCCAGGTTCTTGCTGTA
CTTGTATTCTGGTCTACCTATCTATTAAGAGGAAATAAGAATGGCCCTCCTTTCATCCGCAAGATCTCATCCCGA
CTCTCGAAAAAGCTGAGCGTCTGGCAAACCACTGTCCTAGTCTTCCTCTGGCTCTATATCTGCCGCAATTTTGCA
AAGATTGTTGGCCTCGAGTGTCCCGAGCCTTTAGCCAATCTATACTCGCGCTCCTTTTTTCGGGCAACATGGATT
ACGACAGGGTTAGATGCTGGCTTCTGGACGGCAATGGGGATAAAGCCAAAGTGGCTACGAGATATTGCGTCTCTG
GTTTTCTCTGGGTATTATCTTATCGCAGCCGAACAGGCAGATGAGAAGGTTCGCCGGGTCCGTGCTACGCTCACA
GTAGAGCATATGCGTGTGTCGTGGAATAAGAGCACCACACCGTATCTCTGGGCACTCGCTAAATTGGGCCGCCCG
CGGCTCACGAAGTACCCTCCGCGTGCCATTCGCATCCCCCGACCAGCGTCCTCAATATACAAGGAGCCAACAAAT
GCGTGGCTTTACTTTGATGGGTCATTGGCCGCGCTACGTGATCAAACATGCATTGTCCTGGATATTCCTGGAGGT
GGATTTGTCTCGATGAGCCCGCGGCATTCCGAAGACCGACTTCTGGCTTGGGCAGCGAGAACCAAAGTTCCCGTA
CTGAGTCTCGACTACAAAAAAGCACCGGAGTATCCGTATCCGTATGCTTTGAATGAATGTTATGATGTATATCAC
TCCATTGTCTCCACCCGTGGGCGGTGCTTGGGCCTCAACGGACGGACTCGTCCTCGTGTCGTCATCACTGGTGAT
AGTGCTGGTGGTAACCTCGCTACTGGCGTCACCCTTATGATCCTTCAATCTGGCAGTACACATGCCTCTAGATGG
CAAGGACAAAACATGCTTCCGCCTCCGGATGGACTAGTTCTACCATATCCCGCGCTGAACATGAAGATAGAAAGC
TGGATGACGGAAGAGCAAATGGCTTTAATACAAGAGAAGAGCACACGTCGAACCAATGAGAGCGTGCTTCGAAGA
AAAGATATGGACTATCACCGGTTGACGCCTTTTACCTCTCCGGGAACGTCATTCGGAGATTTCCAGCGTGACTCG
TTCTCTGACGCGGATCTGGAAGTCGGAAATTTGGTTGACGCTACCTCGGAGAAGTTGGCACAGCAACAGAAGATG
GACGTCACTGAAGAGGAGGTGGCTGCCATCACTGAGCACCAGCCTAAGCAGATCCGAACACGACTGGCTGTTTCA
TCGATGATATCGTATGTTAATGATCGTATATTAACCCCCGAGATGATGAGGGCAATGATCATCCTTTACATCGGA
CCGCACAACCGCCCCGACTTCAATACGGACTACCTACTCTCCCCAGCCCTGGCTCCGGAAGAGCTCTTAGCACGT
TTCCCCAAGACGTACATCATCACCGGAGAACGTGACCCTCTAGTTGACGACACGGTCATCTTCGCCGGGCGACTA
AGACAAGCTAAGCTCCGCCAATTCCAGGAACGACAAGAACTGGGCCTCGAAAAGTCTTATCGCAGGTTCAACGCA
AAGGACCATGTCGAGGTTTCCCTATTACCCGGGATCTCTCACGGGTTCATGCAAATGGCCGGCTTCTTCCCCGAT
AGCTGGAAGCACATCTACCGCTGCGCAACTTGGATTCAAGATCTATTCGACCTCGCCCAGACTAAGAAATCATCT
TCTGGCCACCTGAGGGCCCTCACCAACGGCGCACAAATGCGAAAGGGGCCCAAGTCCGTTCCCCGCGGCAATAGC
TCCCGCAATCATAGACGTCGTCTCACGGGAGAGTCATCCGGCGACGAGGATAGGCCTCTTGAGATAGGCATCAAG
AAACTGACACCACTGACACCATTGCATCGCAGCTCCAGCGCACCCATCGACAGTACCGAGATTGATAGTCAAGAT
ATCGCTGCCAAGGATGGCGACAGCGAGGATGCTAAAAAGGAGCGCATCCGTAGCGTCTCCCGAGGCCGAACTCTG
CGGCCAGGGATCACCAGGAAACAGCGTCCCATTCCAATGAGGTTAACGATCCCTCCTCGAGACGGGTATATCTCT
GGATCGCCGAGTCCTATTCCTTTGCGGGAAAGAAACCGGAGTATTAACAGTCTTGCCAGCGAGGAGGACCTGCTT
GACCGGCGTATGAATGGCTTAGCTGGAGGGTTGATGGGCATTGGCGAAGGTGCTAGGACGCCTTAG
Transcript >Ani_SJS72_1|g10134.t1
ATGTCTTCTGCTCCTGACGGGCAACCAATGCTGCCTCTTCCTGGAGCCCCGTCTTCTTCATGGTCCCGATTTCGT
GAGAGATTCGGTGCACTATTTCATGGCGCTGACCCCAGAGTCTGTGTTGCATTCTGGCTACTTGGATTGATCAAC
AATGTCCTCTATGTTATCATTTTGTCCGCAGCCCTCGATTTAGTTGGTCCTAGTGTCCCCAAGGGCGTCGTTCTT
CTCGCAGACGTCATTCCCTCATTCGGAACCAAGCTGATAGCACCCTACTTTATTCATTTGGTTCCATATCCCGCT
CGAGTATTGTTCTGTGTGCTATGTTCAGCCGTGGGTATGCTTCTGGTGGCCCTGAGCCCAGCGTATACAGATGGC
GGTTCAATTTCCACCAAAATCGCGGGCATTATTCTGGCGAGCTTGTCGAGCGGAGGAGGCGAACTGAGCTTCCTA
GCACTGACGCACTTCTACGGCCCGTTCAGTCTGGCAGCCTGGGGTAGTGGTACCGGAGCCGCCGGGCTGGTCGGG
GCTGGTGCGTACGCCGTCGCAACTACCTCTATGGGGCTCAGTGTCAGGTCGACACTCCTAGCAGCTGCCTGCCTG
CCAGCAATCATGGTTGTGAGCTTCTTCGCCATTCTGCCAAGAGCTCCCATACGGACATTGGCCGCTGCACCTGTT
GAGTATCGTGCAATTGACCAGGAAGATCGGGATGACCTTCTGGATGAGCGGCACGGTCTACTCGGCTCCTCAGCT
CCCCCGAGCCGAAACAAGAGGAGCGACGCGAGTCATGAGCTCGGCTTGCAGGTGTTCAAAGCTAACCTGCAGCGA
GCTAGGGGACTTTTCTTTCCCTTCATGCTCCCCCTTCTGCTAGTCTATGTGGCCGAATACACAATCAACCAAGGG
GTTTCTCCGACCCTGCTGTTTCCACTTAAAGATTCGCCGTTTGAACATTATCGTGCATTTTATCCCGCGTACAAT
GCGATCTATCAGGTTGGTGTTTTCATCTCGCGATCGTCCACCCCTTTCTTTCGGATTCACGATCTTTACCTTCCG
TCACTGCTGCAAATCATCAATTTGGTCGTATTGACATTGCACGCCTTGTTTGACTTCATCCCGAGCGTGTACATA
ATATTTATAGTCATCTTCTGGGAAGGGCTATTAGGGGGGCTGGTTTATGTCAATACATTCGCCGAAATCGGGGAC
CGGGTGCCGAAGGAAGACCGAGAATTCTCGCTCGGAGCGACGACTGTCAGCGATTCTGCCGGAATTTGTATAGCG
GGCTTTCTGGGAATGGCGTTTGAGACTTCTTTCAAAGCCTCTATAGACTGCTGCTGCCTGATTGATACCCGGGGG
TGTTTCGGAAAGATGATAGACCACGTCCTTGGGCGGCCATCTACAAAATTCCGGAAAATCCAGGTTCTTGCTGTA
CTTGTATTCTGGTCTACCTATCTATTAAGAGGAAATAAGAATGGCCCTCCTTTCATCCGCAAGATCTCATCCCGA
CTCTCGAAAAAGCTGAGCGTCTGGCAAACCACTGTCCTAGTCTTCCTCTGGCTCTATATCTGCCGCAATTTTGCA
AAGATTGTTGGCCTCGAGTGTCCCGAGCCTTTAGCCAATCTATACTCGCGCTCCTTTTTTCGGGCAACATGGATT
ACGACAGGGTTAGATGCTGGCTTCTGGACGGCAATGGGGATAAAGCCAAAGTGGCTACGAGATATTGCGTCTCTG
GTTTTCTCTGGGTATTATCTTATCGCAGCCGAACAGGCAGATGAGAAGGTTCGCCGGGTCCGTGCTACGCTCACA
GTAGAGCATATGCGTGTGTCGTGGAATAAGAGCACCACACCGTATCTCTGGGCACTCGCTAAATTGGGCCGCCCG
CGGCTCACGAAGTACCCTCCGCGTGCCATTCGCATCCCCCGACCAGCGTCCTCAATATACAAGGAGCCAACAAAT
GCGTGGCTTTACTTTGATGGGTCATTGGCCGCGCTACGTGATCAAACATGCATTGTCCTGGATATTCCTGGAGGT
GGATTTGTCTCGATGAGCCCGCGGCATTCCGAAGACCGACTTCTGGCTTGGGCAGCGAGAACCAAAGTTCCCGTA
CTGAGTCTCGACTACAAAAAAGCACCGGAGTATCCGTATCCGTATGCTTTGAATGAATGTTATGATGTATATCAC
TCCATTGTCTCCACCCGTGGGCGGTGCTTGGGCCTCAACGGACGGACTCGTCCTCGTGTCGTCATCACTGGTGAT
AGTGCTGGTGGTAACCTCGCTACTGGCGTCACCCTTATGATCCTTCAATCTGGCAGTACACATGCCTCTAGATGG
CAAGGACAAAACATGCTTCCGCCTCCGGATGGACTAGTTCTACCATATCCCGCGCTGAACATGAAGATAGAAAGC
TGGATGACGGAAGAGCAAATGGCTTTAATACAAGAGAAGAGCACACGTCGAACCAATGAGAGCGTGCTTCGAAGA
AAAGATATGGACTATCACCGGTTGACGCCTTTTACCTCTCCGGGAACGTCATTCGGAGATTTCCAGCGTGACTCG
TTCTCTGACGCGGATCTGGAAGTCGGAAATTTGGTTGACGCTACCTCGGAGAAGTTGGCACAGCAACAGAAGATG
GACGTCACTGAAGAGGAGGTGGCTGCCATCACTGAGCACCAGCCTAAGCAGATCCGAACACGACTGGCTGTTTCA
TCGATGATATCGTATGTTAATGATCGTATATTAACCCCCGAGATGATGAGGGCAATGATCATCCTTTACATCGGA
CCGCACAACCGCCCCGACTTCAATACGGACTACCTACTCTCCCCAGCCCTGGCTCCGGAAGAGCTCTTAGCACGT
TTCCCCAAGACGTACATCATCACCGGAGAACGTGACCCTCTAGTTGACGACACGGTCATCTTCGCCGGGCGACTA
AGACAAGCTAAGCTCCGCCAATTCCAGGAACGACAAGAACTGGGCCTCGAAAAGTCTTATCGCAGGTTCAACGCA
AAGGACCATGTCGAGGTTTCCCTATTACCCGGGATCTCTCACGGGTTCATGCAAATGGCCGGCTTCTTCCCCGAT
AGCTGGAAGCACATCTACCGCTGCGCAACTTGGATTCAAGATCTATTCGACCTCGCCCAGACTAAGAAATCATCT
TCTGGCCACCTGAGGGCCCTCACCAACGGCGCACAAATGCGAAAGGGGCCCAAGTCCGTTCCCCGCGGCAATAGC
TCCCGCAATCATAGACGTCGTCTCACGGGAGAGTCATCCGGCGACGAGGATAGGCCTCTTGAGATAGGCATCAAG
AAACTGACACCACTGACACCATTGCATCGCAGCTCCAGCGCACCCATCGACAGTACCGAGATTGATAGTCAAGAT
ATCGCTGCCAAGGATGGCGACAGCGAGGATGCTAAAAAGGAGCGCATCCGTAGCGTCTCCCGAGGCCGAACTCTG
CGGCCAGGGATCACCAGGAAACAGCGTCCCATTCCAATGAGGTTAACGATCCCTCCTCGAGACGGGTATATCTCT
GGATCGCCGAGTCCTATTCCTTTGCGGGAAAGAAACCGGAGTATTAACAGTCTTGCCAGCGAGGAGGACCTGCTT
GACCGGCGTATGAATGGCTTAGCTGGAGGGTTGATGGGCATTGGCGAAGGTGCTAGGACGCCTTAG
Gene >Ani_SJS72_1|g10134.t1
ATGTCTTCTGCTCCTGACGGGCAACCAATGCTGCCTCTTCCTGGAGCCCCGTCTTCTTCATGGTCCCGATTTCGT
GAGAGATTCGGTGCACTATTTCATGGCGCTGACCCCAGAGTCTGTGTTGCATTCTGGCTACTTGGTAAGCCGTTG
GCCGTCTTGTAGACACCGCGAACTGATAAGAACTACTCGTGGCTCACTGACCGGCATGCGTGACTCGCAACAGGA
TTGATCAACAATGTCCTCTATGTTATCATTTTGTCCGCAGCCCTCGATTTAGTTGGTCCTAGTGTCCCCAAGGGC
GTCGTTCTTCTCGCAGACGTCATTCCCTCATTCGGAACCAAGCTGATAGCACCCTACTTTATTCATTTGGTTCCA
TATCCCGCTCGAGTATTGTTCTGTGTGCTATGTTCAGCCGTGGGTATGCTTCTGGTGGCCCTGAGCCCAGCGTAT
ACAGATGGCGGTTCAATTTCCACCAAAATCGCGGGCATTATTCTGGCGAGCTTGTCGAGCGGAGGAGGCGAACTG
AGCTTCCTAGCACTGACGCACTTCTACGGCCCGTTCAGTCTGGCAGCCTGGGGTAGTGGTACCGGAGCCGCCGGG
CTGGTCGGGGCTGGTGCGTACGCCGTCGCAACTACCTCTATGGGGCTCAGTGTCAGGTCGACACTCCTAGCAGCT
GCCTGCCTGCCAGCAATCATGGTTGTGAGCTTCTTCGCCATTCTGCCAAGAGCTCCCATACGGACATTGGCCGCT
GCACCTGTTGAGTATCGTGCAATTGACCAGGAAGATCGGGATGACCTTCTGGATGAGCGGCACGGTCTACTCGGC
TCCTCAGCTCCCCCGAGCCGAAACAAGAGGAGCGACGCGAGTCATGAGCTCGGCTTGCAGGTGTTCAAAGCTAAC
CTGCAGCGAGCTAGGGGACTTTTCTTTCCCTTGTAAGTGCACGCTAGTATCATCAAGCAATAATTGGCATGCTTA
CATTTCCGCGCAGCATGCTCCCCCTTCTGCTAGTCTATGTGGCCGAATACACAATCAACCAAGGGGTTTCTCCGA
CCCTGCTGTTTCCACTTAAAGATTCGCCGTTTGAACATTATCGTGCATTTTATCCCGCGTACAATGCGATCTATC
AGGTTGGTGTTTTCATCTCGCGATCGTCCACCCCTTTCTTTCGGATTCACGATCTTTACCTTCCGTCACTGCTGC
AAATCATCAATTTGGTCGTATTGACATTGCACGCCTTGTTTGACTTCATCCCGAGCGTGTACATAATATTTATAG
TCATCTTCTGGGAAGGGCTATTAGGGGGGCTGGTTTATGTCAATACATTCGCCGAAATCGGGGACCGGGTGCCGA
AGGAAGACCGAGAATTCTCGCTCGGAGCGACGACTGTCAGCGATTCTGCCGGAATTTGTATAGCGGGCTTTCTGG
GAATGGCGTTTGAGGTCTGGTTGTGTGATTGGCAGGTCGCCCACGGTCGGGATTATTGCCGGAAACTATGAGCAG
TAGAGAGAACCTTAGAATGATAGGGGAATGAAATGATATACTACTATGCAATCCATATATAATAGATGATAATAA
TTTCTCATGCATTGTTAGCTTCAGTACGGAGTAGAGGCCAACCGGAAATACCAGAAGAGGAATGGCACATGAGTT
GTCTCGTGGCGGATTTGCATGTGACCGGGCCCTCCCGTGACTCGGCACGGGGCAACTCTCCGCGCTTCCCTTCGC
CCACTAAATACCACCTTGTCATTAGTCTTGCTATCATCATCCAGCTAGCCACCGCGGAGGGCCATCAGTGATCGA
CGCCAAAACCCGGCTTTTGGGCCTCTGCCAGACTAACCCCGGTTATTCAAGGACTGCTTACTGACCCTTCCCAGA
TGACTGGATCACCATGCATCTCCTGGTGGGGATTTCACATGCATCACTACGTTTCTTCAGCTGAACCATGGATAC
CCTCGCTCTACGCCAACTACACCTCTTTCTCCCCTCCCCTCATCCCCACATACCCCGTACTTGGGTCACTGAACT
GTGCCATTATTGACCTACTTTGATAATAAACAGGCTAGTGGTCTGCTTGTCGGTTGCTCACCTGTTCCTCTTTTA
CAGTGGTTCGCCGCTTTTGTCCATTCTTTGTCCTTCCATACTGCCCCTCCCATCGTTCCAGTGCGCAGCTGAAAT
ATGACTCTTTCCATTTGATTATCTCCAATTTTTCTACCTCCAATATATTTAAAGCTTCGTGTATATTCCATAGAC
TTCTTTCAAAGCCTCTATAGACTGCTGCTGCCTGATTGATACCCGGGGGTGTTTCGGAAAGATGATAGGTAACTG
ACGGCCCAGCAAACCTCATGGATGTGATGAGGCTGCCGCTAATATATACATCCAGACCACGTCCTTGGGCGGCCA
TCTACAAAATTCCGGAAAATCCAGGTTCTTGCTGTACTTGTATTCTGGTCTACCTATCTATTAAGGTGCGTTTCG
ATTGGTGTCTGCTATCGCTGTTTTGCTGACAGACCACTCGTAGAGGAAATAAGAATGGCCCTCCTTTCATCCGCA
AGATCTCATCCCGACTCTCGAAAAAGCTGAGCGTCTGGCAAACCACTGTCCTAGTCTTCCTCTGGCTCTATATCT
GCCGCAATTTTGCAAAGATTGTTGGCCTCGAGTGTCCCGAGCCTTTAGCCAATCTATACTCGCGCTCCTTTTTTC
GGGCAACATGGATTACGACAGGGTTAGATGCTGGCTTCTGGACGGCAATGGGGATAAAGCCAAAGTGGCTACGAG
ATATTGCGTCTCTGGTTTTCTCTGGGTATTATCTTATCGCAGCCGAACAGGCAGATGAGAAGGTTCGCCGGGTCC
GTGCTACGCTCACAGTAGAGCATATGCGTGTGTCGTGGAATAAGAGCACCACACCGTATCTCTGGGCACTCGCTA
AATTGGGCCGCCCGCGGCTCACGAAGTACCCTCCGCGTGCCATTCGCATCCCCCGACCAGCGTCCTCAATATACA
AGGAGCCAACAAATGCGTGGCTTTACTTTGATGGGTCATTGGCCGCGCTACGTGATCAAACATGCATTGTCCTGG
ATATTCCTGGAGGTGGATTTGTCTCGATGAGCCCGCGGCATTCCGAAGACCGACTTCTGGCTTGGGCAGCGAGAA
CCAAAGTTCCCGTACTGAGTCTCGACTACAAAAAAGCACCGGAGTATCCGTATCCGTATGCTTTGAATGAATGTT
ATGATGTATATCACTCCATTGTCTCCACCCGTGGGCGGTGCTTGGGCCTCAACGGACGGACTCGTCCTCGTGTCG
TCATCACTGGTGATAGTGCTGGTGGTAACCTCGCTACTGGCGTCACCCTTATGATCCTTCAATCTGGCAGTACAC
ATGCCTCTAGATGGCAAGGACAAAACATGCTTCCGCCTCCGGATGGACTAGTTCTACCATATCCCGCGCTGAACA
TGAAGATAGAAAGCTGGATGACGGAAGAGCAAATGGCTTTAATACAAGAGAAGAGCACACGTCGAACCAATGAGA
GCGTGCTTCGAAGAAAAGATATGGACTATCACCGGTTGACGCCTTTTACCTCTCCGGGAACGTCATTCGGAGATT
TCCAGCGTGACTCGTTCTCTGACGCGGATCTGGAAGTCGGAAATTTGGTTGACGCTACCTCGGAGAAGTTGGCAC
AGCAACAGAAGATGGACGTCACTGAAGAGGAGGTGGCTGCCATCACTGAGCACCAGCCTAAGCAGATCCGAACAC
GACTGGCTGTTTCATCGATGATATCGTATGTTAATGATCGTATATTAACCCCCGAGATGATGAGGGCAATGATCA
TCCTTTACATCGGACCGCACAACCGCCCCGACTTCAATACGGACTACCTACTCTCCCCAGCCCTGGCTCCGGAAG
AGCTCTTAGCACGTTTCCCCAAGACGTACATCATCACCGGAGAACGTGACCCTCTAGTTGACGACACGGTCATCT
TCGCCGGGCGACTAAGACAAGCTAAGCTCCGCCAATTCCAGGAACGACAAGAACTGGGCCTCGAAAAGTCTTATC
GCAGGTTCAACGCAAAGGACCATGTCGAGGTTTCCCTATTACCCGGGATCTCTCACGGGTTCATGCAAATGGCCG
GCTTCTTCCCCGATAGCTGGAAGCACATCTACCGCTGCGCAACTTGGATTCAAGATCTATTCGACCTCGCCCAGA
CTAAGAAATCATCTTCTGGCCACCTGAGGGCCCTCACCAACGGCGCACAAATGCGAAAGGGGCCCAAGTCCGTTC
CCCGCGGCAATAGCTCCCGCAATCATAGACGTCGTCTCACGGGAGAGTCATCCGGCGACGAGGATAGGCCTCTTG
AGATAGGCATCAAGAAACTGACACCACTGACACCATTGCATCGCAGCTCCAGCGCACCCATCGACAGTACCGAGA
TTGATAGTCAAGATATCGCTGCCAAGGATGGCGACAGCGAGGATGCTAAAAAGGAGCGCATCCGTAGCGTCTCCC
GAGGCCGAACTCTGCGGCCAGGGATCACCAGGAAACAGCGTCCCATTCCAATGAGGTTAACGATCCCTCCTCGAG
ACGGGTATATCTCTGGATCGCCGAGTCCTATTCCTTTGCGGGAAAGAAACCGGAGTATTAACAGTCTTGCCAGCG
AGGAGGACCTGCTTGACCGGCGTATGAATGGCTTAGCTGGAGGGTTGATGGGCATTGGCGAAGGTGCTAGGACGC
CTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail