Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g10066.t1
Gene name
Locationscaffold_123:43733..45310
Strand-
Gene length (bp)1577
Transcript length (bp)1518
Coding sequence length (bp)1518
Protein length (aa) 506

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02628 COX15-CtaA Cytochrome oxidase assembly protein 7.5E-117 109 466

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0016653 oxidoreductase activity, acting on NAD(P)H, heme protein as acceptor Yes
GO:0006784 heme A biosynthetic process Yes
GO:0016491 oxidoreductase activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0046160 heme a metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006779 porphyrin-containing compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0031224 intrinsic component of membrane No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0033013 tetrapyrrole metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009058 biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0008152 metabolic process No
GO:0033014 tetrapyrrole biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0042168 heme metabolic process No
GO:0016651 oxidoreductase activity, acting on NAD(P)H No
GO:0005575 cellular_component No
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006778 porphyrin-containing compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0042440 pigment metabolic process No
GO:0003824 catalytic activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0046148 pigment biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0110165 cellular anatomical entity No
GO:0006783 heme biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0003674 molecular_function No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 109 131 22
2 193 212 19
3 219 241 22
4 261 283 22
5 319 341 22
6 390 412 22
7 425 447 22
8 452 474 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g10066.t1
MASLGPSVPLLRSLSPRLSRELFTCRQCLVRTQNHATKSAFRRQFSALPFTQNANSRANSALQSRTRKLFASSLK
RSASGSATAEAIAAQGEAAKAKSSFPDVSDKKVAYWLLASAASVFGIVVFGGLTRLTESGLSITEWRPVTGSLPP
MNAEDWESEFSKYRASPEFQLLNPHMTLSEFKSIYYMEWIHRLWGRFVGLSFVLPAAYFVAAKKVSKPMALRLAG
IAGLIGFQGFIGWWMVKSGLKDDLFAPGSHPRVSQYRLTAHLGAAFVCYTAMLWNGLAILRSHRLLADPEAGIKL
LDALRDPKLKIFRRSVAALAALVFVTAMSGALVAGLDAGLIYNEFPFMGNGLAPPKSELFDERYSRHEDRSDLWW
RNMLENPSLVQLDHRALAIITFTSIMALLAYTRGSPTMKRLLPPAAKKGVHGVVAFACMQVGLGISTLLYLVPTP
LASAHQAGSLFLLTWVLVLGSRIWHPSRTAKLLQMAAKARGQALANAAAHAPRRV*
Coding >Ani_SJS72_1|g10066.t1
ATGGCATCCTTGGGGCCTTCCGTGCCCTTGCTGCGAAGCTTGTCTCCCCGGCTATCGAGGGAGCTCTTCACCTGC
CGCCAATGTTTGGTCCGCACTCAAAATCACGCGACTAAATCCGCCTTCCGCAGACAATTCTCCGCCCTGCCCTTC
ACCCAGAACGCCAACAGCAGAGCCAACTCTGCCCTGCAGTCGAGGACCAGAAAGCTTTTTGCGTCTAGCCTGAAA
AGAAGTGCTTCCGGATCAGCAACGGCGGAGGCAATTGCTGCCCAGGGAGAAGCCGCGAAAGCCAAATCTAGCTTC
CCGGATGTGAGCGATAAGAAAGTGGCCTACTGGCTACTGGCCAGCGCGGCCAGCGTGTTTGGCATTGTAGTTTTT
GGCGGCCTTACCAGGTTGACTGAATCAGGTCTGAGTATCACCGAATGGCGCCCTGTCACCGGATCCCTTCCCCCC
ATGAACGCCGAAGACTGGGAGTCAGAATTCTCCAAGTACCGTGCCTCCCCCGAATTTCAGCTTTTGAACCCGCAT
ATGACCCTCTCCGAATTCAAGTCGATTTACTACATGGAATGGATCCACCGTCTCTGGGGCCGCTTTGTCGGCTTG
TCGTTCGTCCTCCCGGCCGCATATTTCGTTGCTGCGAAAAAGGTTAGCAAGCCTATGGCTCTGCGTCTCGCTGGT
ATCGCAGGCTTGATCGGATTTCAAGGTTTTATCGGCTGGTGGATGGTCAAGTCTGGCCTGAAGGATGATCTTTTC
GCTCCCGGCAGCCACCCTCGTGTCAGCCAGTACCGTCTGACAGCGCATCTGGGTGCGGCTTTCGTCTGCTATACT
GCTATGCTCTGGAACGGACTTGCTATCCTGCGCTCCCACCGATTGCTCGCCGACCCGGAAGCTGGAATCAAGCTT
CTTGACGCGCTCCGTGATCCTAAGCTCAAGATCTTCCGTCGCTCCGTCGCCGCTTTGGCTGCATTGGTTTTCGTG
ACTGCCATGTCGGGTGCCCTGGTCGCTGGCCTGGATGCTGGTCTCATCTATAACGAGTTCCCATTTATGGGTAAT
GGCCTGGCTCCTCCTAAGTCTGAATTGTTTGATGAACGGTACTCTCGCCACGAGGACAGATCAGACCTGTGGTGG
AGAAACATGCTGGAGAATCCTTCCCTGGTGCAACTGGACCACCGCGCTCTGGCCATAATTACCTTCACGAGCATC
ATGGCTCTGTTGGCCTACACTCGCGGATCCCCCACCATGAAACGCCTTTTGCCCCCCGCTGCGAAGAAGGGTGTC
CACGGTGTGGTCGCTTTCGCTTGCATGCAGGTTGGTCTGGGTATCTCGACGCTTCTTTACCTTGTTCCCACGCCT
TTGGCCTCTGCCCACCAGGCGGGCAGTCTTTTCCTTCTTACCTGGGTGCTTGTCCTGGGAAGTCGTATCTGGCAC
CCGTCTAGGACGGCTAAGCTGCTTCAGATGGCAGCCAAGGCCCGTGGACAGGCTCTCGCCAACGCCGCGGCCCAT
GCGCCCCGGAGGGTATAA
Transcript >Ani_SJS72_1|g10066.t1
ATGGCATCCTTGGGGCCTTCCGTGCCCTTGCTGCGAAGCTTGTCTCCCCGGCTATCGAGGGAGCTCTTCACCTGC
CGCCAATGTTTGGTCCGCACTCAAAATCACGCGACTAAATCCGCCTTCCGCAGACAATTCTCCGCCCTGCCCTTC
ACCCAGAACGCCAACAGCAGAGCCAACTCTGCCCTGCAGTCGAGGACCAGAAAGCTTTTTGCGTCTAGCCTGAAA
AGAAGTGCTTCCGGATCAGCAACGGCGGAGGCAATTGCTGCCCAGGGAGAAGCCGCGAAAGCCAAATCTAGCTTC
CCGGATGTGAGCGATAAGAAAGTGGCCTACTGGCTACTGGCCAGCGCGGCCAGCGTGTTTGGCATTGTAGTTTTT
GGCGGCCTTACCAGGTTGACTGAATCAGGTCTGAGTATCACCGAATGGCGCCCTGTCACCGGATCCCTTCCCCCC
ATGAACGCCGAAGACTGGGAGTCAGAATTCTCCAAGTACCGTGCCTCCCCCGAATTTCAGCTTTTGAACCCGCAT
ATGACCCTCTCCGAATTCAAGTCGATTTACTACATGGAATGGATCCACCGTCTCTGGGGCCGCTTTGTCGGCTTG
TCGTTCGTCCTCCCGGCCGCATATTTCGTTGCTGCGAAAAAGGTTAGCAAGCCTATGGCTCTGCGTCTCGCTGGT
ATCGCAGGCTTGATCGGATTTCAAGGTTTTATCGGCTGGTGGATGGTCAAGTCTGGCCTGAAGGATGATCTTTTC
GCTCCCGGCAGCCACCCTCGTGTCAGCCAGTACCGTCTGACAGCGCATCTGGGTGCGGCTTTCGTCTGCTATACT
GCTATGCTCTGGAACGGACTTGCTATCCTGCGCTCCCACCGATTGCTCGCCGACCCGGAAGCTGGAATCAAGCTT
CTTGACGCGCTCCGTGATCCTAAGCTCAAGATCTTCCGTCGCTCCGTCGCCGCTTTGGCTGCATTGGTTTTCGTG
ACTGCCATGTCGGGTGCCCTGGTCGCTGGCCTGGATGCTGGTCTCATCTATAACGAGTTCCCATTTATGGGTAAT
GGCCTGGCTCCTCCTAAGTCTGAATTGTTTGATGAACGGTACTCTCGCCACGAGGACAGATCAGACCTGTGGTGG
AGAAACATGCTGGAGAATCCTTCCCTGGTGCAACTGGACCACCGCGCTCTGGCCATAATTACCTTCACGAGCATC
ATGGCTCTGTTGGCCTACACTCGCGGATCCCCCACCATGAAACGCCTTTTGCCCCCCGCTGCGAAGAAGGGTGTC
CACGGTGTGGTCGCTTTCGCTTGCATGCAGGTTGGTCTGGGTATCTCGACGCTTCTTTACCTTGTTCCCACGCCT
TTGGCCTCTGCCCACCAGGCGGGCAGTCTTTTCCTTCTTACCTGGGTGCTTGTCCTGGGAAGTCGTATCTGGCAC
CCGTCTAGGACGGCTAAGCTGCTTCAGATGGCAGCCAAGGCCCGTGGACAGGCTCTCGCCAACGCCGCGGCCCAT
GCGCCCCGGAGGGTATAA
Gene >Ani_SJS72_1|g10066.t1
ATGGCATCCTTGGGGCCTTCCGTGCCCTTGCTGCGAAGCTTGTCTCCCCGGCTATCGAGGGAGCTCTTCACCTGC
CGCCAATGTTTGGTCCGCACTCAAAATCACGCGACTAAATCCGCCTTCCGCAGACAATTCTCCGCCCTGCCCTTC
ACCCAGAACGCCAACAGCAGAGCCAACTCTGCCCTGCAGTCGAGGACCAGAAAGCTTTTTGCGTCTAGCCTGAAA
AGAAGTGCTTCCGGATCAGCAACGGCGGAGGCAATTGCTGCCCAGGGAGAAGCCGCGAAAGCCAAATCTAGCTTC
CCGGATGTGAGCGATAAGAAAGTGGCCTACTGGCTACTGGCCAGCGCGGCCAGCGTGTTTGGCATTGTAGTTTTT
GGCGGCCTTACCAGGTTGACTGAATCAGGGTATGGTCCTTCCATCCATTGCTATATTTCGGACCAATGCTAACGC
AGCCATTTTATAGTCTGAGTATCACCGAATGGCGCCCTGTCACCGGATCCCTTCCCCCCATGAACGCCGAAGACT
GGGAGTCAGAATTCTCCAAGTACCGTGCCTCCCCCGAATTTCAGCTTTTGAACCCGCATATGACCCTCTCCGAAT
TCAAGTCGATTTACTACATGGAATGGATCCACCGTCTCTGGGGCCGCTTTGTCGGCTTGTCGTTCGTCCTCCCGG
CCGCATATTTCGTTGCTGCGAAAAAGGTTAGCAAGCCTATGGCTCTGCGTCTCGCTGGTATCGCAGGCTTGATCG
GATTTCAAGGTTTTATCGGCTGGTGGATGGTCAAGTCTGGCCTGAAGGATGATCTTTTCGCTCCCGGCAGCCACC
CTCGTGTCAGCCAGTACCGTCTGACAGCGCATCTGGGTGCGGCTTTCGTCTGCTATACTGCTATGCTCTGGAACG
GACTTGCTATCCTGCGCTCCCACCGATTGCTCGCCGACCCGGAAGCTGGAATCAAGCTTCTTGACGCGCTCCGTG
ATCCTAAGCTCAAGATCTTCCGTCGCTCCGTCGCCGCTTTGGCTGCATTGGTTTTCGTGACTGCCATGTCGGGTG
CCCTGGTCGCTGGCCTGGATGCTGGTCTCATCTATAACGAGTTCCCATTTATGGGTAATGGCCTGGCTCCTCCTA
AGTCTGAATTGTTTGATGAACGGTACTCTCGCCACGAGGACAGATCAGACCTGTGGTGGAGAAACATGCTGGAGA
ATCCTTCCCTGGTGCAACTGGACCACCGCGCTCTGGCCATAATTACCTTCACGAGCATCATGGCTCTGTTGGCCT
ACACTCGCGGATCCCCCACCATGAAACGCCTTTTGCCCCCCGCTGCGAAGAAGGGTGTCCACGGTGTGGTCGCTT
TCGCTTGCATGCAGGTTGGTCTGGGTATCTCGACGCTTCTTTACCTTGTTCCCACGCCTTTGGCCTCTGCCCACC
AGGCGGGCAGTCTTTTCCTTCTTACCTGGGTGCTTGTCCTGGGAAGTCGTATCTGGCACCCGTCTAGGACGGCTA
AGCTGCTTCAGATGGCAGCCAAGGCCCGTGGACAGGCTCTCGCCAACGCCGCGGCCCATGCGCCCCGGAGGGTAT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail