Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS70_1|g2482.t1
Gene name
Locationscaffold_016:50425..50712
Strand+
Gene length (bp)287
Transcript length (bp)234
Coding sequence length (bp)234
Protein length (aa) 78

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 51 73 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup11369
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 147321 Ani_SJS30_1|g5875.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g3672.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g1525.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g5105.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g2482.t1 (this protein)
Aspergillus niger CBS 147345 Ani_SJS72_1|g3868.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g9261.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g9142.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS70_1|g2482.t1
MLEAESVINKEWHGRGVISMTIEQSASRPVPVKVYDKLNGAFKERPGAVNGVTALLMGSLTGNMVGGITFTAYEL
SA*
Coding >Ani_SJS70_1|g2482.t1
ATGCTCGAAGCGGAGTCGGTCATCAACAAGGAATGGCATGGCCGCGGTGTGATCTCTATGACTATTGAGCAATCG
GCAAGCCGGCCAGTGCCCGTGAAGGTCTACGACAAGCTCAACGGGGCTTTCAAGGAGCGACCCGGTGCCGTCAAC
GGAGTTACAGCCCTGCTGATGGGCTCGCTAACCGGTAACATGGTTGGGGGTATTACATTTACCGCTTACGAGCTA
TCCGCCTAA
Transcript >Ani_SJS70_1|g2482.t1
ATGCTCGAAGCGGAGTCGGTCATCAACAAGGAATGGCATGGCCGCGGTGTGATCTCTATGACTATTGAGCAATCG
GCAAGCCGGCCAGTGCCCGTGAAGGTCTACGACAAGCTCAACGGGGCTTTCAAGGAGCGACCCGGTGCCGTCAAC
GGAGTTACAGCCCTGCTGATGGGCTCGCTAACCGGTAACATGGTTGGGGGTATTACATTTACCGCTTACGAGCTA
TCCGCCTAA
Gene >Ani_SJS70_1|g2482.t1
ATGCTCGAAGCGGAGGTGCGGTTCCTATGTTTCGACATGACCAATAACCAGTCGGTGGATGATACAAGTCGGTCA
TCAACAAGGAATGGCATGGCCGCGGTGTGATCTCTATGACTATTGAGCAATCGGCAAGCCGGCCAGTGCCCGTGA
AGGTCTACGACAAGCTCAACGGGGCTTTCAAGGAGCGACCCGGTGCCGTCAACGGAGTTACAGCCCTGCTGATGG
GCTCGCTAACCGGTAACATGGTTGGGGGTATTACATTTACCGCTTACGAGCTATCCGCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail