Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS70_1|g2404.t1
Gene name
Locationscaffold_015:263439..271415
Strand-
Gene length (bp)7976
Transcript length (bp)6672
Coding sequence length (bp)6672
Protein length (aa) 2224

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14765 PS-DH Polyketide synthase dehydratase 1.8E-60 648 906
PF08659 KR KR domain 2.9E-59 1827 2001
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 4.4E-59 30 279
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 9.7E-37 288 401
PF08242 Methyltransf_12 Methyltransferase domain 2.4E-18 1111 1219
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 8.2E-16 1671 1803
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 3.1E-15 404 484
PF13489 Methyltransf_23 Methyltransferase domain 8.9E-13 1104 1273
PF00698 Acyl_transf_1 Acyl transferase domain 1.7E-11 440 576
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 3.8E-11 1630 1749
PF13649 Methyltransf_25 Methyltransferase domain 3.4E-07 1110 1217
PF00106 adh_short short chain dehydrogenase 1.8E-07 1830 1984
PF08241 Methyltransf_11 Methyltransferase domain 2.1E-06 1111 1221
PF13847 Methyltransf_31 Methyltransferase domain 2.1E-06 1108 1225
PF00550 PP-binding Phosphopantetheine attachment site 1.3E-05 2143 2197
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 9.0E-05 1511 1567

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 11 PKS

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup3250
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g821.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g669.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g2450.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g4953.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g6530.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g3895.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g1065.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g346.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g1476.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g1327.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g4028.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g5160.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g5278.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g4624.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g2404.t1 (this protein)
Aspergillus niger CBS 147345 Ani_SJS72_1|g153.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g1128.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g9528.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g4511.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g2989.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g5732.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g405.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g3073.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g2866.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS70_1|g2404.t1
MDSQDSSPWEISSVERSSQPGTPEEVDSLEPIAIVGMGVRLPGNIHTEQQLWELITEKRSTRGEIPKSRFNVDGF
YSPTGRAGSIAMKHGHFLTEKDNFRHLDTSFFSMGRKEVDDIDPQQRMLLEVVYECMQSSGQVGWSGSKIGCYVG
VWGEDWLDLHAKDTQDAGMYRIPGGHDFAISNRISYEYDLRGPSFTIKAGCSSSLIALHDAVRAIRAGDCSGALV
AGTNLIFSPTMSIAMTEQGVLSPEGSCKTFDAAANGYARGEAINAIYIKSLSEAIKDNDKIRAVIRATATNCDGK
TPGMSMPSSEGHEALIRRAYREASLDPTETVFIEAHGTGTPVGDPLEATAIARVFGGNNDPVYIGSVKPNLGHSE
GASGVSSVIKAVLALENMTIPPNINFSTPNPKIPFQEANMEVPIDPMTWPSGKPLRVSVNSFGIGGANAHAILES
AAPISLQATVAAAASSDPHSVTLSGDLEALEKTCEIIRTEEPGCLVRRLKVEMAYHSHHMLDIGDSLEALLRDRI
DSKAPVVPFFSSVRATRINGAGGLNASYWRENLESPVLFYGAAANRSNDSYITAMIRGKDCTESILHMAGELYLN
NIPVDFGHICPTGCLLTNLPSYKWQHDHEYWAESRLSKEWRFREFPHHELLGSRILEGNDLQPEWRNVLRLEDVP
WLRDHQVINDIIFPCAGYLGMAGEAIRQISSAHEFIFRDVVVHTALVLTESKAIEMITSLRPVRLTTTLDSVWWE
FSIFSYNETAWVKHCVGQIRTGATHSSSPLPCPSHPRSTENLYPILTKVGLNYGPCFRGLSHVSCLPNKNTASAR
LLPTVVSESTYAVHPTTIDHCLQLLFPASCDGIYRRVTRLCVPTKIEQLYLCGGRSDNDAVAEAVATISSAGVLS
GRVVAKSDKGVFLSLVGGKFSPLEVDTADDLDPIGAAKLHWKPDLDLADMRTLIKASDSSHIDSLELELVEKMAL
LSLIEVNVQTSHLVCDIEHLEKYRSWMHRQTSRASSNSYDLVPNAKDLLSLDSDTRLALIFKLNQLLSHTDAASA
AELISRIVDNCSAIMQGKVEGIEVLQARDGLTNYYNFVESRTDSVDFFAVAGHTKPTLRVLEIGAGTGGGTAVVL
RGLTTSPTPRRERMYSKYAFTDISAGFFVPAQERFKEYEGIEYKVLDITKDPIEQGFQAESYDLIIAGNVLHATP
SINATLANVRKLLAPEGYLFLQELSPQLQMVNLIMGILPGWWLGETDGRVNEPFLTPEEWNKALKMAGFSGVEAA
IYDGPRPYHINANIISRPVRESILGPRRVTLLHSVGNVPTTNVDRLQKSLIDNGYQVDLRTLQEGAPADQDIVSV
LELESPLFESVSHEVLLAFQDLIASRGDSKILWVTRPAQKDVSSTPGFGLTLGLARTLRSEQFLSFMTLEVDRVD
DQVYPAIVRVLGKIQSHDSTASVDADSEFILRNGVVHVGRYQPASVAQDLELMASKPGAVRLAIGRPGLLQSLQW
IPFPTTEPRHGEVVVEPRCAGLNFRDVLLAMGIVEANNLGIGLEGSGVITDVGAGVTDLQVGDRVFYLDDNCFST
RITMSAMRCAKIPSFLSYEEAATMPCVYATVIHSLVDIGGLQSGQSVLIHSACGGIGIAAINVCQSIGGVQVYVT
VGNQDKVRYLMETFNIPRASIFNSRDTSFREDVLAHTNGRGVDLVLNSLSGELLHASWECVAPYGKMLEIGKRDF
IGKAKLSMDIFEANRSFIGIDLARFDAARCHPLLTRTVQMLEAGHIKPIAPRTTFSAGHIEDSFRYMQKGTHMGK
IVVTIPEGGRELPIAPIIPDLTMKANASYLLVGGMGGLGRAVATWLVEKGARHLVFFSRSAGNSEQDRRFIQELE
SQGCSVRAIQGSVLNEKDVARITQATEKPIKGVFQMSMVLRDKPFMEMDLQDWTTAVGPKVQGTWNLHHAMPSDL
DFFFATGSISGSFGTPGQANYAAGNTFLNAFTQYRRSLGLPTSILHIGLMDDVGYLTQNVGKAEALRAAGGYFLR
EKDLLDSLQWAIVKATISSATADSDEAQLTIGLRCDKRLSDPTNRVIWRKDARMGLYHNRDTESSSSSNGSNGSQ
ADALKAFMASVEADPEVVLKEPASLEVVTREMAVKIYTFMLHPLDDLDVNVSLTALGVDSLVTIEIRNWMKRSLG
GIEISTLEILNAGSIASLGRLVIEALKKKFISQITVAEGDAYLEMKAP*
Coding >Ani_SJS70_1|g2404.t1
ATGGATAGTCAAGACTCGTCTCCCTGGGAGATCTCCTCTGTGGAGCGCTCGAGTCAGCCGGGAACCCCCGAGGAA
GTTGATTCTTTGGAGCCCATAGCGATTGTTGGCATGGGCGTGAGGCTGCCCGGGAATATCCACACAGAGCAGCAG
CTCTGGGAACTCATTACGGAGAAGCGATCCACGCGGGGCGAGATCCCCAAGAGTCGGTTCAACGTGGACGGGTTC
TACAGTCCCACAGGCCGGGCTGGATCGATAGCAATGAAACATGGCCATTTTCTGACAGAGAAAGATAATTTCAGA
CATCTGGATACATCTTTCTTCTCGATGGGCCGGAAGGAGGTAGATGACATCGATCCACAGCAACGTATGTTACTT
GAAGTCGTATACGAATGCATGCAATCTTCAGGTCAAGTGGGCTGGAGCGGCAGCAAGATCGGCTGCTACGTTGGA
GTCTGGGGTGAAGATTGGTTGGACCTCCATGCGAAAGATACTCAGGATGCAGGCATGTATCGGATCCCTGGTGGA
CATGACTTTGCCATCTCGAACCGCATTAGCTACGAATACGACTTGAGAGGCCCCTCCTTCACCATAAAGGCCGGG
TGCTCATCGTCTTTGATCGCCTTGCATGACGCTGTTCGAGCCATTCGTGCAGGTGACTGTTCAGGAGCACTTGTT
GCAGGCACAAATCTCATTTTCTCACCTACAATGTCCATCGCTATGACAGAGCAAGGGGTGCTATCTCCCGAAGGT
TCTTGCAAGACATTTGACGCGGCAGCAAACGGGTACGCCAGGGGCGAAGCCATTAACGCCATCTATATCAAGTCC
CTTTCTGAGGCAATAAAAGACAACGACAAAATCCGCGCCGTGATCAGAGCTACTGCGACTAATTGTGATGGAAAG
ACGCCGGGTATGTCGATGCCCAGCTCTGAAGGCCATGAAGCATTGATCCGTCGAGCATATCGAGAGGCGTCGCTT
GACCCCACGGAGACCGTGTTTATCGAAGCACACGGCACAGGCACGCCCGTCGGTGACCCCCTCGAGGCTACGGCA
ATTGCACGGGTATTTGGAGGGAATAATGACCCCGTATATATTGGAAGTGTCAAGCCGAACCTGGGTCATAGCGAG
GGCGCTTCCGGAGTCTCCTCCGTCATTAAGGCCGTGTTGGCATTGGAGAACATGACCATCCCTCCAAATATAAAC
TTCTCGACTCCGAACCCAAAGATCCCATTCCAGGAGGCAAACATGGAGGTTCCAATTGACCCAATGACGTGGCCA
TCCGGTAAACCGCTAAGAGTGAGTGTGAATTCATTCGGCATTGGGGGCGCAAACGCACACGCCATCCTCGAGAGT
GCTGCTCCGATTTCTCTGCAAGCGACTGTAGCTGCCGCCGCTAGTAGCGATCCGCATAGTGTAACATTGTCAGGA
GATCTCGAAGCTCTCGAGAAGACCTGTGAAATCATTCGGACTGAGGAACCGGGGTGCTTGGTTCGAAGGCTAAAG
GTCGAGATGGCCTACCATTCTCACCATATGCTTGACATTGGCGACTCCCTCGAGGCCCTGCTACGCGATCGCATT
GACAGCAAAGCTCCCGTAGTGCCCTTCTTCTCGAGCGTCCGCGCAACGAGGATAAATGGCGCGGGGGGTTTGAAC
GCAAGCTATTGGCGAGAAAATCTCGAAAGCCCTGTACTCTTTTACGGTGCCGCTGCTAATCGGTCCAACGACAGC
TACATCACAGCCATGATCCGTGGCAAGGACTGCACCGAATCCATCCTGCATATGGCTGGGGAGCTTTACTTGAAC
AATATACCAGTGGATTTCGGACATATTTGCCCGACTGGGTGCCTGCTGACCAATCTTCCATCATACAAATGGCAG
CACGATCATGAGTACTGGGCCGAAAGCAGATTGAGCAAAGAGTGGAGGTTCCGCGAGTTCCCTCATCATGAACTA
TTGGGATCCAGAATACTGGAGGGGAATGATCTGCAGCCCGAATGGCGAAACGTCCTTCGCCTAGAAGATGTACCA
TGGCTTCGGGATCATCAAGTCATCAACGATATCATATTCCCCTGCGCAGGGTACCTTGGAATGGCAGGCGAGGCC
ATCCGACAGATATCATCTGCCCATGAATTTATCTTCCGGGATGTCGTGGTGCACACAGCATTGGTATTGACCGAG
TCAAAGGCGATTGAGATGATCACTAGTCTTCGTCCGGTCAGGTTGACAACTACCCTGGACTCTGTCTGGTGGGAG
TTTAGTATATTCTCATACAATGAGACTGCCTGGGTTAAACATTGCGTGGGACAGATCAGGACGGGGGCTACACAT
TCTTCGTCTCCCTTGCCGTGTCCCAGCCATCCCCGTTCAACCGAGAATTTATATCCCATACTGACGAAAGTTGGT
CTCAACTATGGGCCATGCTTCCGCGGATTATCCCACGTCTCTTGTCTGCCGAACAAGAACACAGCCTCTGCCAGG
TTGCTGCCAACCGTGGTTTCCGAGTCCACCTACGCTGTTCACCCTACGACCATTGATCACTGCCTGCAGCTGTTG
TTCCCAGCTAGCTGTGACGGGATTTACCGGCGTGTAACCCGTTTGTGTGTTCCGACAAAAATCGAACAGCTCTAC
CTCTGCGGCGGCAGGAGTGACAATGATGCAGTCGCGGAGGCCGTTGCCACCATCAGTTCTGCTGGCGTTCTTTCC
GGAAGAGTAGTAGCCAAGTCCGATAAGGGAGTTTTCTTGTCCCTAGTCGGAGGGAAGTTTTCTCCCCTCGAGGTG
GATACAGCCGATGATCTTGACCCTATTGGCGCAGCAAAGTTACACTGGAAACCAGATCTCGACCTAGCCGACATG
AGGACTTTGATAAAGGCCAGCGATAGCTCGCATATTGATTCTCTTGAGCTCGAGCTCGTCGAGAAGATGGCCCTA
CTCAGTCTCATTGAAGTGAACGTTCAGACATCTCATCTAGTCTGTGATATTGAGCATCTTGAAAAATATCGCTCG
TGGATGCATCGGCAAACAAGTCGAGCCTCGAGCAATAGCTACGACTTGGTTCCGAATGCTAAGGATTTGCTATCC
CTGGATTCTGATACTAGGCTTGCGTTGATATTCAAGCTGAACCAGTTGTTATCGCACACTGATGCCGCAAGCGCA
GCTGAGCTTATATCCAGGATAGTGGATAACTGCTCTGCTATTATGCAGGGAAAGGTGGAGGGAATCGAAGTACTG
CAAGCTCGCGATGGACTGACCAACTACTACAATTTTGTCGAGTCACGAACTGACTCTGTTGATTTCTTCGCTGTT
GCAGGTCATACCAAGCCCACGTTGAGAGTGTTGGAAATCGGGGCTGGCACTGGAGGGGGCACAGCAGTTGTCCTG
CGGGGCCTAACCACCTCGCCCACCCCAAGACGTGAGCGTATGTACTCAAAGTACGCTTTTACTGATATCTCTGCT
GGGTTCTTTGTCCCAGCGCAGGAGAGGTTTAAGGAATACGAAGGGATCGAGTATAAGGTACTCGACATTACAAAG
GACCCGATCGAGCAAGGGTTCCAGGCAGAATCGTACGATTTGATCATCGCAGGCAACGTCTTACATGCAACTCCC
AGTATTAATGCAACTCTGGCGAACGTGCGTAAGCTGCTGGCACCTGAGGGCTATCTGTTTCTCCAGGAATTATCG
CCCCAGCTGCAAATGGTGAACCTGATTATGGGGATTCTTCCGGGATGGTGGCTGGGCGAAACTGACGGTAGAGTC
AATGAGCCGTTTTTGACACCAGAAGAATGGAACAAGGCATTGAAAATGGCCGGTTTCTCTGGGGTTGAGGCGGCG
ATCTATGATGGCCCTCGCCCATACCACATCAACGCCAATATTATCTCCCGACCTGTACGGGAGTCCATTCTGGGA
CCTCGTCGTGTTACTCTTCTTCACAGTGTTGGCAACGTACCTACAACTAACGTTGACCGCCTCCAGAAGTCTCTT
ATCGATAATGGTTATCAGGTCGACTTGAGAACCCTTCAAGAGGGAGCACCAGCCGATCAAGACATTGTCTCAGTG
CTGGAGCTCGAAAGTCCCCTCTTTGAAAGCGTATCTCATGAAGTCCTATTGGCCTTTCAGGATCTTATTGCCAGT
CGAGGAGATAGCAAAATACTATGGGTCACTAGGCCGGCCCAAAAGGATGTGAGTTCTACTCCGGGGTTCGGTCTG
ACCCTAGGGCTCGCTCGAACATTGCGATCGGAACAGTTCCTCTCTTTTATGACCCTGGAAGTCGACCGCGTCGAT
GACCAGGTTTATCCGGCTATCGTGCGTGTATTGGGCAAAATCCAATCGCATGACTCGACGGCATCAGTGGATGCA
GATTCCGAGTTCATCCTCCGTAACGGAGTGGTCCATGTTGGCCGATATCAGCCAGCCTCGGTGGCACAGGACCTG
GAACTTATGGCGTCAAAGCCTGGCGCTGTCAGACTGGCGATTGGTCGTCCAGGTCTGCTACAGTCACTGCAGTGG
ATTCCTTTCCCCACAACCGAACCTCGCCATGGGGAAGTTGTCGTTGAGCCTCGTTGTGCAGGCCTAAATTTTAGA
GATGTGCTTCTCGCTATGGGGATTGTGGAAGCTAACAACCTTGGCATTGGACTCGAGGGATCGGGCGTGATCACA
GACGTAGGTGCCGGAGTGACTGATCTCCAGGTGGGCGATCGAGTCTTTTACCTCGATGATAACTGCTTCTCTACT
CGGATCACCATGTCGGCTATGAGATGTGCGAAGATCCCATCGTTCCTCTCATACGAAGAAGCGGCCACGATGCCA
TGTGTTTACGCTACTGTCATTCATTCGCTTGTGGACATCGGTGGCTTGCAGAGCGGCCAGTCGGTTTTGATACAC
TCAGCATGTGGAGGTATTGGAATTGCAGCCATCAATGTCTGCCAAAGTATTGGTGGGGTTCAGGTATATGTAACA
GTCGGAAATCAGGATAAAGTTCGATATCTCATGGAGACCTTCAACATTCCGCGTGCCAGCATCTTTAATTCCCGT
GACACCTCCTTCCGAGAGGACGTGCTTGCCCACACTAATGGACGCGGCGTCGATCTCGTGCTCAACAGCTTGTCG
GGTGAGCTTCTTCATGCATCCTGGGAATGTGTAGCTCCGTACGGCAAGATGCTCGAGATCGGCAAAAGAGACTTT
ATTGGAAAAGCTAAGTTGAGCATGGACATCTTTGAAGCGAACAGAAGCTTTATCGGTATCGATCTCGCCAGATTC
GACGCTGCGAGATGTCACCCTCTACTCACTCGTACGGTGCAAATGCTCGAGGCCGGACATATCAAACCCATCGCA
CCTAGGACAACCTTCTCTGCTGGTCATATTGAAGACAGTTTCCGTTACATGCAGAAAGGGACACACATGGGAAAG
ATCGTCGTGACTATTCCTGAAGGAGGCCGGGAACTGCCAATCGCTCCAATTATCCCAGATTTAACCATGAAGGCC
AACGCATCATACCTACTCGTGGGAGGAATGGGCGGTCTGGGCCGAGCAGTAGCAACGTGGTTAGTCGAGAAAGGA
GCTAGGCACCTTGTCTTCTTCTCCCGATCAGCCGGAAACTCGGAACAGGACCGACGGTTCATCCAGGAACTAGAA
TCGCAAGGATGCAGTGTGAGAGCTATTCAAGGGAGCGTCTTGAATGAGAAGGACGTGGCTCGCATCACCCAAGCC
ACAGAAAAACCAATCAAGGGGGTCTTCCAAATGTCAATGGTACTTCGAGACAAGCCATTCATGGAAATGGACCTC
CAAGACTGGACCACCGCAGTCGGGCCCAAAGTGCAAGGAACGTGGAACCTACACCACGCGATGCCAAGCGACCTA
GACTTCTTCTTCGCAACCGGATCCATCAGCGGGTCCTTTGGAACTCCCGGTCAAGCCAACTACGCTGCAGGCAAC
ACATTCCTCAACGCCTTCACACAATACCGGAGAAGTCTGGGTCTGCCCACCTCAATCTTGCACATCGGCCTCATG
GACGACGTTGGGTATCTGACTCAGAATGTGGGAAAGGCCGAGGCCCTTCGCGCTGCAGGCGGGTACTTTCTTCGG
GAAAAGGACCTCTTGGATTCTCTTCAGTGGGCTATTGTAAAGGCCACCATAAGCAGTGCGACGGCAGACAGCGAC
GAGGCCCAATTGACCATCGGGCTCCGGTGCGACAAGCGACTCTCTGACCCAACAAACCGAGTCATATGGAGAAAG
GATGCTCGCATGGGACTATACCACAACCGAGACACCGAGTCATCCAGCAGCAGCAATGGTAGTAACGGTAGTCAA
GCGGATGCGCTCAAGGCATTTATGGCATCCGTGGAAGCAGATCCGGAGGTTGTGCTCAAGGAGCCTGCGTCACTG
GAAGTGGTGACGCGGGAAATGGCTGTCAAAATATACACCTTCATGCTACATCCATTGGATGACCTGGACGTGAAC
GTATCGCTAACCGCTTTGGGTGTCGATTCCCTGGTTACAATTGAGATCCGGAACTGGATGAAGAGAAGTTTAGGC
GGCATTGAGATCAGCACATTGGAAATCTTGAATGCGGGGTCCATTGCTAGTTTAGGAAGATTGGTGATCGAGGCG
TTGAAGAAGAAATTTATCTCTCAGATTACGGTGGCAGAAGGGGATGCTTATCTGGAAATGAAGGCCCCGTGA
Transcript >Ani_SJS70_1|g2404.t1
ATGGATAGTCAAGACTCGTCTCCCTGGGAGATCTCCTCTGTGGAGCGCTCGAGTCAGCCGGGAACCCCCGAGGAA
GTTGATTCTTTGGAGCCCATAGCGATTGTTGGCATGGGCGTGAGGCTGCCCGGGAATATCCACACAGAGCAGCAG
CTCTGGGAACTCATTACGGAGAAGCGATCCACGCGGGGCGAGATCCCCAAGAGTCGGTTCAACGTGGACGGGTTC
TACAGTCCCACAGGCCGGGCTGGATCGATAGCAATGAAACATGGCCATTTTCTGACAGAGAAAGATAATTTCAGA
CATCTGGATACATCTTTCTTCTCGATGGGCCGGAAGGAGGTAGATGACATCGATCCACAGCAACGTATGTTACTT
GAAGTCGTATACGAATGCATGCAATCTTCAGGTCAAGTGGGCTGGAGCGGCAGCAAGATCGGCTGCTACGTTGGA
GTCTGGGGTGAAGATTGGTTGGACCTCCATGCGAAAGATACTCAGGATGCAGGCATGTATCGGATCCCTGGTGGA
CATGACTTTGCCATCTCGAACCGCATTAGCTACGAATACGACTTGAGAGGCCCCTCCTTCACCATAAAGGCCGGG
TGCTCATCGTCTTTGATCGCCTTGCATGACGCTGTTCGAGCCATTCGTGCAGGTGACTGTTCAGGAGCACTTGTT
GCAGGCACAAATCTCATTTTCTCACCTACAATGTCCATCGCTATGACAGAGCAAGGGGTGCTATCTCCCGAAGGT
TCTTGCAAGACATTTGACGCGGCAGCAAACGGGTACGCCAGGGGCGAAGCCATTAACGCCATCTATATCAAGTCC
CTTTCTGAGGCAATAAAAGACAACGACAAAATCCGCGCCGTGATCAGAGCTACTGCGACTAATTGTGATGGAAAG
ACGCCGGGTATGTCGATGCCCAGCTCTGAAGGCCATGAAGCATTGATCCGTCGAGCATATCGAGAGGCGTCGCTT
GACCCCACGGAGACCGTGTTTATCGAAGCACACGGCACAGGCACGCCCGTCGGTGACCCCCTCGAGGCTACGGCA
ATTGCACGGGTATTTGGAGGGAATAATGACCCCGTATATATTGGAAGTGTCAAGCCGAACCTGGGTCATAGCGAG
GGCGCTTCCGGAGTCTCCTCCGTCATTAAGGCCGTGTTGGCATTGGAGAACATGACCATCCCTCCAAATATAAAC
TTCTCGACTCCGAACCCAAAGATCCCATTCCAGGAGGCAAACATGGAGGTTCCAATTGACCCAATGACGTGGCCA
TCCGGTAAACCGCTAAGAGTGAGTGTGAATTCATTCGGCATTGGGGGCGCAAACGCACACGCCATCCTCGAGAGT
GCTGCTCCGATTTCTCTGCAAGCGACTGTAGCTGCCGCCGCTAGTAGCGATCCGCATAGTGTAACATTGTCAGGA
GATCTCGAAGCTCTCGAGAAGACCTGTGAAATCATTCGGACTGAGGAACCGGGGTGCTTGGTTCGAAGGCTAAAG
GTCGAGATGGCCTACCATTCTCACCATATGCTTGACATTGGCGACTCCCTCGAGGCCCTGCTACGCGATCGCATT
GACAGCAAAGCTCCCGTAGTGCCCTTCTTCTCGAGCGTCCGCGCAACGAGGATAAATGGCGCGGGGGGTTTGAAC
GCAAGCTATTGGCGAGAAAATCTCGAAAGCCCTGTACTCTTTTACGGTGCCGCTGCTAATCGGTCCAACGACAGC
TACATCACAGCCATGATCCGTGGCAAGGACTGCACCGAATCCATCCTGCATATGGCTGGGGAGCTTTACTTGAAC
AATATACCAGTGGATTTCGGACATATTTGCCCGACTGGGTGCCTGCTGACCAATCTTCCATCATACAAATGGCAG
CACGATCATGAGTACTGGGCCGAAAGCAGATTGAGCAAAGAGTGGAGGTTCCGCGAGTTCCCTCATCATGAACTA
TTGGGATCCAGAATACTGGAGGGGAATGATCTGCAGCCCGAATGGCGAAACGTCCTTCGCCTAGAAGATGTACCA
TGGCTTCGGGATCATCAAGTCATCAACGATATCATATTCCCCTGCGCAGGGTACCTTGGAATGGCAGGCGAGGCC
ATCCGACAGATATCATCTGCCCATGAATTTATCTTCCGGGATGTCGTGGTGCACACAGCATTGGTATTGACCGAG
TCAAAGGCGATTGAGATGATCACTAGTCTTCGTCCGGTCAGGTTGACAACTACCCTGGACTCTGTCTGGTGGGAG
TTTAGTATATTCTCATACAATGAGACTGCCTGGGTTAAACATTGCGTGGGACAGATCAGGACGGGGGCTACACAT
TCTTCGTCTCCCTTGCCGTGTCCCAGCCATCCCCGTTCAACCGAGAATTTATATCCCATACTGACGAAAGTTGGT
CTCAACTATGGGCCATGCTTCCGCGGATTATCCCACGTCTCTTGTCTGCCGAACAAGAACACAGCCTCTGCCAGG
TTGCTGCCAACCGTGGTTTCCGAGTCCACCTACGCTGTTCACCCTACGACCATTGATCACTGCCTGCAGCTGTTG
TTCCCAGCTAGCTGTGACGGGATTTACCGGCGTGTAACCCGTTTGTGTGTTCCGACAAAAATCGAACAGCTCTAC
CTCTGCGGCGGCAGGAGTGACAATGATGCAGTCGCGGAGGCCGTTGCCACCATCAGTTCTGCTGGCGTTCTTTCC
GGAAGAGTAGTAGCCAAGTCCGATAAGGGAGTTTTCTTGTCCCTAGTCGGAGGGAAGTTTTCTCCCCTCGAGGTG
GATACAGCCGATGATCTTGACCCTATTGGCGCAGCAAAGTTACACTGGAAACCAGATCTCGACCTAGCCGACATG
AGGACTTTGATAAAGGCCAGCGATAGCTCGCATATTGATTCTCTTGAGCTCGAGCTCGTCGAGAAGATGGCCCTA
CTCAGTCTCATTGAAGTGAACGTTCAGACATCTCATCTAGTCTGTGATATTGAGCATCTTGAAAAATATCGCTCG
TGGATGCATCGGCAAACAAGTCGAGCCTCGAGCAATAGCTACGACTTGGTTCCGAATGCTAAGGATTTGCTATCC
CTGGATTCTGATACTAGGCTTGCGTTGATATTCAAGCTGAACCAGTTGTTATCGCACACTGATGCCGCAAGCGCA
GCTGAGCTTATATCCAGGATAGTGGATAACTGCTCTGCTATTATGCAGGGAAAGGTGGAGGGAATCGAAGTACTG
CAAGCTCGCGATGGACTGACCAACTACTACAATTTTGTCGAGTCACGAACTGACTCTGTTGATTTCTTCGCTGTT
GCAGGTCATACCAAGCCCACGTTGAGAGTGTTGGAAATCGGGGCTGGCACTGGAGGGGGCACAGCAGTTGTCCTG
CGGGGCCTAACCACCTCGCCCACCCCAAGACGTGAGCGTATGTACTCAAAGTACGCTTTTACTGATATCTCTGCT
GGGTTCTTTGTCCCAGCGCAGGAGAGGTTTAAGGAATACGAAGGGATCGAGTATAAGGTACTCGACATTACAAAG
GACCCGATCGAGCAAGGGTTCCAGGCAGAATCGTACGATTTGATCATCGCAGGCAACGTCTTACATGCAACTCCC
AGTATTAATGCAACTCTGGCGAACGTGCGTAAGCTGCTGGCACCTGAGGGCTATCTGTTTCTCCAGGAATTATCG
CCCCAGCTGCAAATGGTGAACCTGATTATGGGGATTCTTCCGGGATGGTGGCTGGGCGAAACTGACGGTAGAGTC
AATGAGCCGTTTTTGACACCAGAAGAATGGAACAAGGCATTGAAAATGGCCGGTTTCTCTGGGGTTGAGGCGGCG
ATCTATGATGGCCCTCGCCCATACCACATCAACGCCAATATTATCTCCCGACCTGTACGGGAGTCCATTCTGGGA
CCTCGTCGTGTTACTCTTCTTCACAGTGTTGGCAACGTACCTACAACTAACGTTGACCGCCTCCAGAAGTCTCTT
ATCGATAATGGTTATCAGGTCGACTTGAGAACCCTTCAAGAGGGAGCACCAGCCGATCAAGACATTGTCTCAGTG
CTGGAGCTCGAAAGTCCCCTCTTTGAAAGCGTATCTCATGAAGTCCTATTGGCCTTTCAGGATCTTATTGCCAGT
CGAGGAGATAGCAAAATACTATGGGTCACTAGGCCGGCCCAAAAGGATGTGAGTTCTACTCCGGGGTTCGGTCTG
ACCCTAGGGCTCGCTCGAACATTGCGATCGGAACAGTTCCTCTCTTTTATGACCCTGGAAGTCGACCGCGTCGAT
GACCAGGTTTATCCGGCTATCGTGCGTGTATTGGGCAAAATCCAATCGCATGACTCGACGGCATCAGTGGATGCA
GATTCCGAGTTCATCCTCCGTAACGGAGTGGTCCATGTTGGCCGATATCAGCCAGCCTCGGTGGCACAGGACCTG
GAACTTATGGCGTCAAAGCCTGGCGCTGTCAGACTGGCGATTGGTCGTCCAGGTCTGCTACAGTCACTGCAGTGG
ATTCCTTTCCCCACAACCGAACCTCGCCATGGGGAAGTTGTCGTTGAGCCTCGTTGTGCAGGCCTAAATTTTAGA
GATGTGCTTCTCGCTATGGGGATTGTGGAAGCTAACAACCTTGGCATTGGACTCGAGGGATCGGGCGTGATCACA
GACGTAGGTGCCGGAGTGACTGATCTCCAGGTGGGCGATCGAGTCTTTTACCTCGATGATAACTGCTTCTCTACT
CGGATCACCATGTCGGCTATGAGATGTGCGAAGATCCCATCGTTCCTCTCATACGAAGAAGCGGCCACGATGCCA
TGTGTTTACGCTACTGTCATTCATTCGCTTGTGGACATCGGTGGCTTGCAGAGCGGCCAGTCGGTTTTGATACAC
TCAGCATGTGGAGGTATTGGAATTGCAGCCATCAATGTCTGCCAAAGTATTGGTGGGGTTCAGGTATATGTAACA
GTCGGAAATCAGGATAAAGTTCGATATCTCATGGAGACCTTCAACATTCCGCGTGCCAGCATCTTTAATTCCCGT
GACACCTCCTTCCGAGAGGACGTGCTTGCCCACACTAATGGACGCGGCGTCGATCTCGTGCTCAACAGCTTGTCG
GGTGAGCTTCTTCATGCATCCTGGGAATGTGTAGCTCCGTACGGCAAGATGCTCGAGATCGGCAAAAGAGACTTT
ATTGGAAAAGCTAAGTTGAGCATGGACATCTTTGAAGCGAACAGAAGCTTTATCGGTATCGATCTCGCCAGATTC
GACGCTGCGAGATGTCACCCTCTACTCACTCGTACGGTGCAAATGCTCGAGGCCGGACATATCAAACCCATCGCA
CCTAGGACAACCTTCTCTGCTGGTCATATTGAAGACAGTTTCCGTTACATGCAGAAAGGGACACACATGGGAAAG
ATCGTCGTGACTATTCCTGAAGGAGGCCGGGAACTGCCAATCGCTCCAATTATCCCAGATTTAACCATGAAGGCC
AACGCATCATACCTACTCGTGGGAGGAATGGGCGGTCTGGGCCGAGCAGTAGCAACGTGGTTAGTCGAGAAAGGA
GCTAGGCACCTTGTCTTCTTCTCCCGATCAGCCGGAAACTCGGAACAGGACCGACGGTTCATCCAGGAACTAGAA
TCGCAAGGATGCAGTGTGAGAGCTATTCAAGGGAGCGTCTTGAATGAGAAGGACGTGGCTCGCATCACCCAAGCC
ACAGAAAAACCAATCAAGGGGGTCTTCCAAATGTCAATGGTACTTCGAGACAAGCCATTCATGGAAATGGACCTC
CAAGACTGGACCACCGCAGTCGGGCCCAAAGTGCAAGGAACGTGGAACCTACACCACGCGATGCCAAGCGACCTA
GACTTCTTCTTCGCAACCGGATCCATCAGCGGGTCCTTTGGAACTCCCGGTCAAGCCAACTACGCTGCAGGCAAC
ACATTCCTCAACGCCTTCACACAATACCGGAGAAGTCTGGGTCTGCCCACCTCAATCTTGCACATCGGCCTCATG
GACGACGTTGGGTATCTGACTCAGAATGTGGGAAAGGCCGAGGCCCTTCGCGCTGCAGGCGGGTACTTTCTTCGG
GAAAAGGACCTCTTGGATTCTCTTCAGTGGGCTATTGTAAAGGCCACCATAAGCAGTGCGACGGCAGACAGCGAC
GAGGCCCAATTGACCATCGGGCTCCGGTGCGACAAGCGACTCTCTGACCCAACAAACCGAGTCATATGGAGAAAG
GATGCTCGCATGGGACTATACCACAACCGAGACACCGAGTCATCCAGCAGCAGCAATGGTAGTAACGGTAGTCAA
GCGGATGCGCTCAAGGCATTTATGGCATCCGTGGAAGCAGATCCGGAGGTTGTGCTCAAGGAGCCTGCGTCACTG
GAAGTGGTGACGCGGGAAATGGCTGTCAAAATATACACCTTCATGCTACATCCATTGGATGACCTGGACGTGAAC
GTATCGCTAACCGCTTTGGGTGTCGATTCCCTGGTTACAATTGAGATCCGGAACTGGATGAAGAGAAGTTTAGGC
GGCATTGAGATCAGCACATTGGAAATCTTGAATGCGGGGTCCATTGCTAGTTTAGGAAGATTGGTGATCGAGGCG
TTGAAGAAGAAATTTATCTCTCAGATTACGGTGGCAGAAGGGGATGCTTATCTGGAAATGAAGGCCCCGTGA
Gene >Ani_SJS70_1|g2404.t1
ATGGATAGTCAAGACTCGTCTCCCTGGGAGATCTCCTCTGTGGAGCGCTCGAGTCAGCCGGGAACCCCCGAGGAA
GTTGATTCTTTGGAGCCCATAGCGATTGTTGGCATGGGCGTGAGGCTGCCCGGGAATATCCACACAGAGCAGCAG
CTCTGGGAACTCATTACGGAGAAGCGATCCACGCGGGGCGAGATCCCCAAGAGTCGGTTCAACGTGGACGGGTTC
TACAGTCCCACAGGCCGGGCTGGATCGATAGCAATGAAACATGGCCATTTTCTGACAGAGAAAGATAATTTCAGA
CATCTGGATACATCTTTCTTCTCGATGGGCCGGAAGGAGGTAGATGACATCGATCCACAGCAACGTATGTTACTT
GAAGTCGTATACGAATGCATGCAATCTTCAGGTCAAGTGGGCTGGAGCGGCAGCAAGATCGGCTGCTACGTTGGA
GTCTGGGGTGAAGTAAGTTGATAAGGACAAGAGTTATGAAGATCAAGAGCTGACGCTGAAACCTATCCGCCGTCA
GGATTGGTTGGACCTCCATGCGAAAGATACTCAGGATGCAGGCATGTATCGGATCCCTGGTGGACATGACTTTGC
CATCTCGAACCGCATTAGCTACGAATACGACTTGAGAGGCCCCTCCTTCACCATAAAGGCCGGGTGCTCATCGTC
TTTGATCGCCTTGCATGACGCTGTTCGAGCCATTCGTGCAGGTGACTGTTCAGGAGCACTTGTTGCAGGCACAAA
TCTCATTTTCTCACCTACAATGTCCATCGCTATGACAGAGCAAGGGGTGCTATCTCCCGAAGGTTCTTGCAAGAC
ATTTGACGCGGCAGCAAACGGGTACGCCAGGGGCGAAGCCATTAACGCCATCTATATCAAGTCCCTTTCTGAGGC
AATAAAAGACAACGACAAAATCCGCGCCGTGATCAGAGCTACTGCGACTAATTGTGATGGAAAGACGCCGGGTAT
GTCGATGCCCAGCTCTGAAGGCCATGAAGCATTGATCCGTCGAGCATATCGAGAGGCGTCGCTTGACCCCACGGA
GACCGTGTTTATCGAAGCACACGGCACAGGCACGCCCGTCGGTGACCCCCTCGAGGCTACGGCAATTGCACGGGT
ATTTGGAGGGAATAATGACCCCGTATATATTGGAAGTGTCAAGCCGAACCTGGGTCATAGCGAGGGCGCTTCCGG
AGTCTCCTCCGTCATTAAGGCCGTGTTGGCATTGGAGAACATGACCATCCCTCCAAATATAAACTTCTCGACTCC
GAACCCAAAGATCCCATTCCAGGAGGCAAACATGGAGGTTCCAATTGACCCAATGACGTGGCCATCCGGTAAACC
GCTAAGAGTGAGTGTGAATTCATTCGGCATTGGGGGCGCAAACGCACACGCCATCCTCGAGAGTGCTGCTCCGAT
TTCTCTGCAAGCGACTGTAGCTGCCGCCGCTAGTAGCGAGTACGTGGCCGGAGCCTTGAATGATCGTTATACAAA
CTATCACACAACTCATCCCAAGGACACGGACGAGCCCTGCAGACTGGTGCGTCCTCCTAGTTCTAGAAGATTCAT
CCATGTATTCTCAGCAGCACACCCGGCATCCCTAAAAGAAAGCTTAGTCGAGCATGAACGATACATCAGAGAAAA
TCCTTCTTTGATGGCTGATATATCCTACACTTTGTGCAATCGACGAGAGCACTTGGCGAACCGGGCTTATTGTGT
TACCAGTTCCTCAGATGGACCCCTCACGTTCTCGCCTGTTACGAAGACGAAGAGAACATCACCAATAACGATGGT
ATTCACTGGACAAGGGGCACAATGGGCAGGAATGGCCAAGGAGCTGATGGATGACTACCCTTCCTTTGACAAGGA
CATAATTTACCTAGGCGCCGTGCTAGCGAAGCTAGAGCACGCCCCATCGTGGGATCTCAGAGATGAACTGCGCAA
ACCAGAAGAAGATAGCAACCTACCCAAAGCGGAGTATTCTCAACCCTTAGTGGCGGCTGTTCAGGTGGCTTTGGT
GAACCTCCTCCGTCAATAGGGCATCCGGCCTAACGCGGTTGTGGGTCACTCAAGCGGAGAAATTGCAGCGGCATA
TGCTGCAAAAGCAATCACGGCCGAGGAAGCAATCACAATTGCTTACTACCGCGGGTACGTGACGAAAGGATATCA
ACGGCCCGGTGGAATGGCTGCTATAGGCCTAGGCCGTGAGCAAGTGACACGATATTTGAGACAGGGGACATTGAT
AGCCTGTGAGAACAGTCCGCATAGTGTAACATTGTCAGGAGATCTCGAAGCTCTCGAGAAGACCTGTGAAATCAT
TCGGACTGAGGAACCGGGGTGCTTGGTTCGAAGGCTAAAGGTCGAGATGGCCTACCATTCTCGTATGTGACCTCA
GTCCATTTCACCAAGTTTGTTTGAGATTATGGTATACTGACTTTTCACCCACAGACCATATGCTTGACATTGGCG
ACTCCCTCGAGGCCCTGCTACGCGATCGCATTGACAGCAAAGCTCCCGTAGTGCCCTTCTTCTCGAGCGTCCGCG
CAACGAGGATAAATGGCGCGGGGGGTTTGAACGCAAGCTATTGGCGAGAAAATCTCGAAAGCCCTGTACTCTTTT
ACGGTGCCGTAAGTCATTTGGTAGAGAGTGAAGCATGTTCTGAGCACACCTTTCTCGAAGTCGGACCACATGGTG
CTTTAAGAGGACCGCTCCGTCAAATATTGCAGGCTGCTAATCGGTCCAACGACAGCTACATCACAGCCATGATCC
GTGGCAAGGACTGCACCGAATCCATCCTGCATATGGCTGGGGAGCTTTACTTGAACAATATACCAGTGGATTTCG
GACATATTTGCCCGACTGGGTGCCTGCTGACCAATCTTCCATCATACAAATGGCAGCACGATCATGAGTACTGGG
CCGAAAGCAGATTGAGCAAAGAGTGGAGGTTCCGCGAGTTCCCTCATCATGAACTATTGGGATCCAGAATACTGG
AGGGGAATGATCTGCAGCCCGAATGGCGAAACGTCCTTCGCCTAGAAGATGTACCATGGCTTCGGGATCATCAAG
TCATCAACGATATCATATTCCCCTGCGCAGGGTACCTTGGAATGGCAGGCGAGGCCATCCGACAGATATCATCTG
CCCATGAATTTATCTTCCGGGATGTCGTGGTGCACACAGCATTGGTATTGACCGAGTCAAAGGCGATTGAGATGA
TCACTAGTCTTCGTCCGGTCAGGTTGACAACTACCCTGGACTCTGTCTGGTGGGAGTTTAGTATATTCTCATACA
ATGAGACTGCCTGGGTTAAACATTGCGTGGGACAGATCAGGACGGGGGCTACACATTCTTCGTCTCCCTTGCCGT
GTCCCAGCCATCCCCGTTCAACCGAGAATTTATATCCCATACTGACGAAAGTTGGTCTCAACTATGGGCCATGCT
TCCGCGGATTATCCCACGTCTCTTGTCTGCCGAACAAGAACACAGCCTCTGCCAGGTTGCTGCCAACCGTGGTTT
CCGAGTCCACCTACGCTGTTCACCCTACGACCATTGATCACTGCCTGCAGCTGTTGTTCCCAGCTAGCTGTGACG
GGATTTACCGGCGTGTAACCCGTTTGTGTGTTCCGACAAAAATCGAACAGCTCTACCTCTGCGGCGGCAGGAGTG
ACAATGATGCAGTCGCGGAGGCCGTTGCCACCATCAGTTCTGCTGGCGTTCTTTCCGGAAGAGTAGTAGCCAAGT
CCGATAAGGGAGTTTTCTTGTCCCTAGTCGGAGGGAAGTTTTCTCCCCTCGAGGTGGATACAGCCGATGATCTTG
ACCCTATTGGCGCAGCAAAGTTACACTGGAAACCAGATCTCGACCTAGCCGACATGAGGACTTTGATAAAGGCCA
GCGATAGCTCGCATATTGATTCTCTTGAGCTCGAGCTCGTCGAGAAGATGGCCCTACTCAGTCTCATTGAAGTGA
ACGTTCAGACATCTCATCTAGTCTGTGATATTGAGCATCTTGAAAAATATCGCTCGTGGATGCATCGGCAAACAA
GTCGAGCCTCGAGCAATAGCTACGACTTGGTTCCGAATGCTAAGGATTTGCTATCCCTGGATTCTGATACTAGGC
TTGCGTTGATATTCAAGCTGAACCAGTTGTTATCGCACACTGATGCCGCAAGCGCAGCTGAGCTTATATCCAGGA
TAGTGGATAACTGCTCTGCTATTATGCAGGGAAAGGTGGAGGGAATCGAAGTACTGCAAGCTCGCGATGGACTGA
CCAACTACTACAATTTTGTCGAGTCACGAACTGACTCTGTTGATTTCTTCGCTGTTGCAGGTCATACCAAGCCCA
CGTTGAGAGTGTTGGAAATCGGGGCTGGCACTGGAGGGGGCACAGCAGTTGTCCTGCGGGGCCTAACCACCTCGC
CCACCCCAAGACGTGAGCGTATGTACTCAAAGTACGCTTTTACTGATATCTCTGCTGGGTTCTTTGTCCCAGCGC
AGGAGAGGTTTAAGGAATACGAAGGGATCGAGTATAAGGTACTCGACATTACAAAGGACCCGATCGAGCAAGGGT
TCCAGGCAGAATCGTACGATTTGATCATCGCAGGCAACGTCTTACATGCAACTCCCAGTATTAATGCAACTCTGG
CGAACGTGCGTAAGCTGCTGGCACCTGAGGGCTATCTGTTTCTCCAGGAATTATCGCCCCAGCTGCAAATGGTGA
ACCTGTAAGTGTGCTATGTTCCCAGCTACTCCTATCCCAGTGAAAGCTAATTCAGCGAAAATAGGATTATGGGGA
TTCTTCCGGGATGGTGGCTGGGCGAAACTGACGGTAGAGTCAATGAGCCGTTTTTGACACCAGAAGAATGGAACA
AGGCATTGAAAATGGCCGGTTTCTCTGGGGTTGAGGCGGCGATCTATGATGGCCCTCGCCCATACCACATCAACG
CCAATATTATCTCCCGACCTGTACGGGAGTCCATTCTGGGACCTCGTCGTGTTACTCTTCTTCACAGTGTTGGCA
ACGTACCTACAACTAACGTTGACCGCCTCCAGAAGTCTCTTATCGATAATGGTTATCAGGTCGACTTGAGAACCC
TTCAAGAGGGAGCACCAGCCGATCAAGACATTGTCTCAGTGCTGGAGCTCGAAAGTCCCCTCTTTGAAAGCGTAT
CTCATGAAGTCCTATTGGCCTTTCAGGATCTTATTGCCAGTCGAGGAGATAGCAAAATACTATGGGTCACTAGGC
CGGCCCAAAAGGATGTGAGTTCTACTCCGGGGTTCGGTCTGACCCTAGGGCTCGCTCGAACATTGCGATCGGAAC
AGTTCCTCTCTTTTATGACCCTGGAAGTCGACCGCGTCGATGACCAGGTTTATCCGGCTATCGTGCGTGTATTGG
GCAAAATCCAATCGCATGACTCGACGGCATCAGTGGATGCAGATTCCGAGTTCATCCTCCGTAACGGAGTGGTCC
ATGTTGGCCGATATCAGCCAGCCTCGGTGGCACAGGACCTGGAACTTATGGCGTCAAAGCCTGGCGCTGTCAGAC
TGGCGATTGGTCGTCCAGGTCTGCTACAGTCACTGCAGTGGATTCCTTTCCCCACAACCGAACCTCGCCATGGGG
AAGTTGTCGTTGAGCCTCGTTGTGCAGGCCTAAATTTTAGAGTAAGCGCCACCGCTCTTCCCGTGATTTCAATTT
CTCGTAATTACTGACAAATCTTGGGATTCTAGGATGTGCTTCTCGCTATGGGGATTGTGGAAGCTAACAACCTTG
GCATTGGACTCGAGGGATCGGGCGTGATCACAGACGTAGGTGCCGGAGTGACTGATCTCCAGGTGGGCGATCGAG
TCTTTTACCTCGATGATAACTGCTTCTCTACTCGGATCACCATGTCGGCTATGAGATGTGCGAAGATCCCATCGT
TCCTCTCATACGAAGAAGCGGCCACGATGCCATGTGTTTACGCTACTGTCATTCATTCGCTTGTGGACATCGGTG
GCTTGCAGAGCGGCCAGTCGGTTTTGATACACTCAGCATGTGGAGGTATTGGAATTGCAGCCATCAATGTCTGCC
AAAGTATTGGTGGGGTTCAGGTAAGCATTTGTTTTCAATGACATGGCTGGACTCACGTGGCGAACTAATGCCTGA
CCATTTTGTGCAGGTATATGTAACAGTCGGAAATCAGGATAAAGTTCGATATCTCATGGAGACCTTCAACATTCC
GCGTGCCAGCATCTTTAATTCCCGTGACACCTCCTTCCGAGAGGACGTGCTTGCCCACACTAATGGACGCGGCGT
CGATCTCGTGCTCAACAGCTTGTCGGGTGAGCTTCTTCATGCATCCTGGGAATGTGTAGCTCCGTACGGCAAGAT
GCTCGAGATCGGCAAAAGAGACTTTATTGGAAAAGCTAAGTTGAGCATGGACATCTTTGAAGCGAACAGAAGCTT
TATCGGTATCGATCTCGCCAGATTCGACGCTGCGAGATGTCACCCGTAAGTCCTATTCTTTCGTGTACCCCAAGG
TCTTTTGTGTTTTAGGAACCACTGTCCTGACCCGACCTAATGATCCCAGTCTACTCACTCGTACGGTGCAAATGC
TCGAGGCCGGACATATCAAACCCATCGCACCTAGGACAACCTTCTCTGCTGGTCATATTGAAGACAGTTTCCGTT
ACATGCAGAAAGGGACACACATGGGAAAGATCGTCGTGACTATTCCTGAAGGAGGCCGGGAACTGCCAATCGCTC
CAATTATCCCAGATTTAACCATGAAGGCCAACGCATCATACCTACTCGTGGGAGGAATGGGCGGTCTGGGCCGAG
CAGTAGCAACGTGGTTAGTCGAGAAAGGAGCTAGGCACCTTGTCTTCTTCTCCCGATCAGCCGGAAACTCGGAAC
AGGACCGACGGTTCATCCAGGAACTAGAATCGCAAGGATGCAGTGTGAGAGCTATTCAAGGGAGCGTCTTGAATG
AGAAGGACGTGGCTCGCATCACCCAAGCCACAGAAAAACCAATCAAGGGGGTCTTCCAAATGTCAATGGTACTTC
GAGACAAGCCATTCATGGAAATGGACCTCCAAGACTGGACCACCGCAGTCGGGCCCAAAGTGCAAGGAACGTGGA
ACCTACACCACGCGATGCCAAGCGACCTAGACTTCTTCTTCGCAACCGGATCCATCAGCGGGTCCTTTGGAACTC
CCGGTCAAGCCAACTACGCTGCAGGCAACACATTCCTCAACGCCTTCACACAATACCGGAGAAGTCTGGGTCTGC
CCACCTCAATCTTGCACATCGGCCTCATGGACGACGTTGGGTATCTGACTCAGAATGTGGGAAAGGCCGAGGCCC
TTCGCGCTGCAGGCGGGTACTTTCTTCGGGAAAAGGACCTCTTGGATTCTCTTCAGTGGGCTATTGTAAAGGCCA
CCATAAGCAGTGCGACGGCAGACAGCGACGAGGCCCAATTGACCATCGGGCTCCGGTGCGACAAGCGACTCTCTG
ACCCAACAAACCGAGTCATATGGAGAAAGGATGCTCGCATGGGACTATACCACAACCGAGACACCGAGTCATCCA
GCAGCAGCAATGGTAGTAACGGTAGTCAAGCGGATGCGCTCAAGGCATTTATGGCATCCGTGGAAGCAGATCCGG
AGGTTGTGCTCAAGGAGCCTGCGTCACTGGAAGTGGTGACGCGGGAAATGGCTGTCAAAATATACACCTTCATGC
TACATCCATTGGATGACCTGGACGTGAACGTATCGCTAACCGCTTTGGGTGTCGATTCCCTGGTTACAATTGAGA
TCCGGAACTGGATGAAGAGAAGTTTAGGCGGCATTGAGATCAGCACATTGGAAATCTTGAATGCGGGGTCCATTG
CTAGTTTAGGAAGATTGGTGATCGAGGCGTTGAAGAAGAAATTTATCTCTCAGATTACGGTGGCAGAAGGGGATG
CTTATCTGGAAATGAAGGCCCCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail